KEGG   Anabaena cylindrica: Anacy_5356Help
Entry
Anacy_5356        CDS       T02435                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acy  Anabaena cylindrica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Anacy_5356
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Anacy_5356
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Anacy_5356
Enzymes [BR:acy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Anacy_5356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6072837..6074141)
Genome map
AA seq 434 aa AA seqDB search
MTQAIANLNQANTSILQALKCKECGAEYELKASHVCELCFGPLEVKYDYDALRLSVSREK
IQAGPNSIWRYRQFLPVATDNVIDVGTGMTPLVRSHRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPSDLEAGKIIGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWEL
PDHIVAPLASGSLFTKIYKGFKEFVEVGLVEGKNVRFSGAQAEGCSPIAKAFKEGRDFIQ
PVKPNTIAKSIAIGNPADGVYAVEIAQKTGGNIESVNDAEIIEGMKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAIQGYIGEPLTIDAKLDSFERALER
SRTLDRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcaattgcaaacttaaaccaagcaaacacttctatactgcaagccttgaag
tgtaaggaatgtggagcagaatatgaactcaaagctagtcatgtttgtgaattgtgcttt
ggtccgctagaagtcaaatatgactacgatgctttacgtctttccgtcagccgagaaaaa
atccaagctgggccaaattcaatttggcgctaccgtcaatttttaccagttgctactgat
aatgttatagatgtgggaacggggatgactcccttagtgcgatcgcaccgtctcgcccgt
cgcctgggattaaataaactttatattaaaaatgatgccgtcaatatgcccaccctgagc
ttcaaagatcgggtggtgtcagttgcacttagtagagctagagaattaggttttactaca
gtctcttgtgccagtacaggcaacttagcaaattccacagcagcgatcgctgcccatgcc
ggtttagactgttgtgtattcatcccctccgacttggaagcaggtaaaataatcggtagc
ttaatttacagcccaaccctcatggctgtcaaaggcaattatgatcaagtaaatcgtctc
tgctcagaagttgccaacacacacggttggggttttgtcaatattaatttacgcccttat
tattccgaaggttccaagacattaggctttgaagtagcagaacaactaggttgggaatta
ccagatcatatagttgctcccctagcctctggttctctgttcaccaagatttataaaggt
ttcaaagaatttgtagaagtcggcttggtagaaggtaaaaacgtccgtttcagcggcgct
caagctgaaggttgctctcccattgctaaagccttcaaagaaggacgcgactttatccag
ccagtcaaaccaaacacaattgcaaaatcaattgctattggtaatccagctgatggcgtt
tatgcagtggaaatagctcagaaaactggcggtaacattgaatcagtcaatgatgcagaa
ataatcgaaggcatgaagctactggcagaaacagaaggtatcttcaccgaaacagctggc
ggtacaacagttgcagtcctgaaaaaattggtagaagctggcaaaattgatccagatgaa
actacagtggtttacattactggcaatggtttgaaaacccaagaagcaattcaaggctac
ataggcgaacctttgacaattgatgccaaactagatagttttgaacgggctttagaaaga
tcccggacacttgatcgcttagaatggcaacaagtcctcgtttaa

DBGET integrated database retrieval system