KEGG   Anabaena cylindrica: Anacy_5421Help
Entry
Anacy_5421        CDS       T02435                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
acy  Anabaena cylindrica
Brite
Enzymes [BR:acy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Anacy_5421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6143033..6143731)
Genome map
AA seq 232 aa AA seqDB search
MIELYYWTTPNGHKITIFLEEVEIPYTIIPINIGAGEQFQPDFLEISPNNRIPAIVDDEP
ANGSAPISIFESGAILLYLAEKTGKLISQDVCGRVEVLQWLFWQMGGLGPMAGQNHHFSQ
YAPEKIEYAINRYVKETGRLYAVLNKRLADREFVAGDYSIADIAIYPWIVSYELQGQNLE
DFPHVSRWFETIKNRSAVIRAYEKAEEFKNQALNIEKSRDLLFNQSSNTVQR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattgagctttattattggacaactccaaatggtcataaaatcacaattttcttggaa
gaagtagaaattccctacaccatcatccctatcaatatcggtgcgggtgagcaatttcag
cctgatttcctggaaatttctccgaataatcgcattcccgcaattgttgatgatgaacca
gcaaatggaagtgcgccaatttccatctttgagtctggagctatattattatatttagca
gaaaaaactgggaaattaatttctcaagatgtgtgtggacgagtggaagttctccagtgg
ttattttggcaaatgggtggtttagggccaatggccggacagaaccatcattttagccag
tatgctcctgaaaaaatagagtatgctattaatcgctacgttaaagaaactggccgttta
tatgcagtattgaataagcgacttgcagatagagaatttgtagccggtgattattctatt
gctgatattgccatttatccttggattgtttcttatgaacttcaaggccaaaacctagaa
gattttccccatgtttcacgctggtttgaaaccataaaaaaccgttcagcagtaattcgt
gcttacgagaaagctgaggagtttaaaaatcaagctcttaatatcgaaaaatcaagagat
ttgttatttaaccagtcaagtaatactgtacaacgttaa

DBGET integrated database retrieval system