KEGG   Anabaena cylindrica: Anacy_5593Help
Entry
Anacy_5593        CDS       T02435                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
acy  Anabaena cylindrica
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Anacy_5593
Enzymes [BR:acy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Anacy_5593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6361146..6362201)
Genome map
AA seq 351 aa AA seqDB search
MSNQIQDYNPSGIAEMNGNLLGLPYDYESANLIIFAVPWEVTVSYGAGTANGPQRILDAS
FQIDLFDFDNPDGWKQGIFMVEIPQDILEKNHYYRQQAAKIIERQAEGKPLTNTPDLTPV
LTEINQAGEQLNQWLFQHCQTAMNQGKKVAVIGGDHSSPLGYFQALAAKYESYGILHIDA
HADLRDSYEEFEFSHASIMFNAMKIPQISKLVQVGLRDICQDEVDIINDSNGRIIAYYDH
AIKQKLYSGNTWIDICREIINHLPENVYISFDVDGLDPKLCPNTGTPVPGGLELEQAYCL
FRELVNSGRKIIGFDLCEVGDAEWDGNVGARIVYKLANLLNLSQKNSTYGN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaaattcaagactacaaccccagcggtatagctgaaatgaatggtaattta
ctgggtttaccttatgattacgagtctgcaaacttgattatctttgccgtaccttgggaa
gttacagtttcctatggggcgggtactgctaacgggccacaacggattttagatgcgtca
ttccaaatagatttattcgattttgataatcctgatggttggaagcagggaatttttatg
gtggaaattccccaagatattttagaaaaaaatcattactatcgtcaacaagcagccaaa
attatcgaaagacaagcagaaggtaaaccgctaacaaatacacctgatttaacacctgta
ctaacagaaattaatcaagcaggtgaacagttgaatcaatggttgtttcaacattgccaa
acagcgatgaatcagggtaaaaaagttgctgtcattggtggtgatcatagctcacctttg
ggttatttccaagccttagctgctaaatatgagagttatggaattctgcacattgacgca
cacgcagatttgcgcgactcttatgaggaatttgaattttcccatgcgtcgattatgttc
aatgcgatgaaaataccgcaaatttctaagttagtgcaagtaggtttgcgggatatttgt
caagatgaagttgatataatcaatgattctaatgggcggattatagcttattatgatcat
gcgattaaacaaaagttatattctggaaatacttggattgatatatgtcgagaaattatc
aatcatttacctgaaaatgtttatattagctttgatgtggatgggttagatcctaaactg
tgtccaaatactggaactccggttcctgggggattggaattagaacaagcttattgtttg
tttagggaattggtaaatagcggtagaaaaattattggttttgatttgtgtgaagtcggt
gatgctgagtgggatggtaatgttggtgcgaggatagtttataagttggcgaatttattg
aatttatcccagaaaaacagtacttacggaaattaa

DBGET integrated database retrieval system