KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0160Help
Entry
Adeh_0160         CDS       T00326                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_0160
   00030 Pentose phosphate pathway
    Adeh_0160
   00051 Fructose and mannose metabolism
    Adeh_0160
   00052 Galactose metabolism
    Adeh_0160
   00500 Starch and sucrose metabolism
    Adeh_0160
   00520 Amino sugar and nucleotide sugar metabolism
    Adeh_0160
  Nucleotide metabolism
   00230 Purine metabolism
    Adeh_0160
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Adeh_0160
Enzymes [BR:ade01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Adeh_0160
    5.4.2.8  phosphomannomutase
     Adeh_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
183230..184600
Genome map
AA seq 456 aa AA seqDB search
MAKLSPTIFREYDIRGLVDQDLTEEAVSLVGKALGTRIRGAGGKRAAVGWDARLSGPKFA
KAMIEALTSTGVDVVSLGVVPTPLTYFAAHTLDVDGICMITGSHNPPEYNGLKVGLGSAT
YYGEEIQALRREAEAGRFATGQGTVRAHDIVTPYREHVRQNLRLGKRRLKVVVDAGNGTG
GVVAVPLFEALGFEVIPLFIEMDGNFPNHHPDPTVEKNLEHLRRKVLETAADVGIAYDGD
ADRVGAVDEKGNVLWGDQIMILFSRALLAEEPGAAIVGEVKCSFTLYDDIAARGGRGIMW
KAGHSLIKAKMKEEHALLAGEMSGHIFFAHRWFGFDDGIYSSARLLELLTHTDRPMSALL
ADVPRTFSTPELRVDCPEDRKFEVVRRAQEFFAARYEAVTVDGVRVVFPDGWGLVRASNT
QPLLVLRFEAKTEARLAEIQALVRGKVDELLRELGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctccccgaccatcttccgcgagtacgacatccgcgggctggtggaccag
gacctcaccgaggaggcggtctcgctcgtcggcaaggcgctcggcacgcgcatccggggc
gcgggcgggaagcgcgccgccgtgggctgggacgcgcgcctctccgggccgaagttcgcg
aaggccatgatcgaggcgctcacctccaccggcgtggacgtggtgagcctcggggtggtg
ccgacgcccctcacctacttcgccgcccacaccctcgacgtggacggcatctgcatgatc
accggctcgcacaacccgccggagtacaacgggctcaaggtcggcctcggctcggccacc
tactacggcgaggagatccaggcgctgcgccgcgaggcggaggcggggcgcttcgccacg
ggccagggcaccgtccgcgcgcacgacatcgtgacgccgtaccgcgagcacgtccggcag
aacctccggctggggaagcgccgcctgaaggtggtcgtggacgccggcaacgggaccggc
ggcgtggtggcggtcccgctgttcgaggcgctcgggttcgaggtgatcccgctgttcatc
gagatggacggcaacttcccgaaccaccaccccgacccgaccgtggagaagaacctcgag
cacctgcggcgcaaggtgctcgagaccgcggcggacgtgggcatcgcctacgacggcgac
gccgaccgggtgggcgcggtggacgagaagggcaacgtgctctggggcgaccagatcatg
atcctcttctcccgggcgctgctcgccgaggagccgggcgccgccatcgtgggcgaggtg
aagtgctccttcacgctctacgacgacatcgccgcccggggcgggcggggcatcatgtgg
aaggccggccacagcctcatcaaggcgaagatgaaggaggagcacgcgctgctcgccggc
gagatgagcgggcacatcttcttcgcccaccgctggttcgggttcgacgacggcatctac
tcgtcggcgcggctgctcgagctgctcacgcacaccgaccggcccatgtccgcgctgctc
gccgacgtgccgcggacgttctccacgcccgagctgcgggtggactgccccgaggaccgg
aagttcgaggtcgtgcgccgggcccaggagttcttcgcggcccgctacgaggcggtgacc
gtggacggcgtgcgggtggtgttccccgacggctggggcctggtgcgcgcctccaacacc
cagccgctgctggtgctgcgcttcgaggcgaagaccgaggcgcggctcgccgagatccag
gcgctggtgcgcggcaaggtggacgagctgctgcgcgagctgggggcatag

DBGET integrated database retrieval system