KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0161Help
Entry
Adeh_0161         CDS       T00326                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00010  Glycolysis / Gluconeogenesis
ade00052  Galactose metabolism
ade00500  Starch and sucrose metabolism
ade00520  Amino sugar and nucleotide sugar metabolism
ade00521  Streptomycin biosynthesis
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01130  Biosynthesis of antibiotics
ade01200  Carbon metabolism
Module
ade_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_0161
   00052 Galactose metabolism
    Adeh_0161
   00500 Starch and sucrose metabolism
    Adeh_0161
   00520 Amino sugar and nucleotide sugar metabolism
    Adeh_0161
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Adeh_0161
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Adeh_0161
Enzymes [BR:ade01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Adeh_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Glucokinase BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ABC79938
UniProt: Q2IMA9
Position
184604..185566
Genome map
AA seq 320 aa AA seqDB search
MKGLALGVDLGGTNARAAVVDRATGEIVASHKEPLHERGPEAVVATVVHALGQAAGAAGI
APASAGRVGVGVAGQVLGATGVVMNAPNLGWRDVAFGALLEKALGVPVRVANDLSVAAWG
EKRFGAARGIEDVVLVFVGSGVGSGLILGGRLHDGAQGVAGELGHIKVRLPRPGFTPRRC
GCGQLGCLEAYTSGVNVAARVREEIAAGAATRVLELAEGDLARVTASVVEEAHALGDAYA
VALWDEVSELLGLAVANLVTLLNPARLILGGGVLLGAPRLAALTLRRFDDAVSRSATRGL
TVERAWLGDDAGVIGAAVLE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggggctcgcgctcggcgtggacctcgggggcaccaacgcgcgcgccgcggtggtg
gaccgcgccaccggcgagatcgtcgcctcgcacaaggagccgctgcacgagcgcgggccg
gaggcggtggtcgcgacggtcgtccacgcgctcggccaggcggccggcgccgccgggatc
gcgccggcgtcggcgggccgggtcggggtgggcgtggccgggcaggtgctcggcgccacc
ggcgtggtgatgaacgcgcccaacctgggctggcgcgacgtggcgttcggcgcgctgctg
gagaaggcgctgggcgtgccggtgcgggtcgcgaacgacctgtcggtcgcggcctggggg
gagaagcgcttcggcgccgcccgcggcatcgaggacgtggtgctggtgttcgtcggctcc
ggcgtgggctccgggctcatcctgggcggccggctgcacgacggggcccagggcgtggcc
ggggagctcggccacatcaaggtgcgcctgccgcgcccggggttcacgccccgccgctgc
ggctgcggccagctcggctgcctcgaggcctacacctcgggcgtgaacgtggccgcgcgg
gtccgcgaggagatcgcggccggcgccgccacccgggtgctggagctggcggagggcgac
ctcgcccgcgtcaccgccagcgtggtggaggaggcgcacgcgctgggcgacgcctacgcc
gtggcgctgtgggacgaggtctccgagctgctcggcctcgccgtggcgaacctcgtcacg
ctgctcaaccccgcccggctcatcctgggcggcggcgtgctgctgggcgccccccgcctc
gccgccctgacgctccgccggttcgacgacgcggtatcgcggtcggccacgcgcgggctc
accgtggagcgcgcctggctcggcgacgacgccggggtcatcggcgccgcggtgctcgag
tag

DBGET integrated database retrieval system