KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0161Help
Entry
Adeh_0161         CDS       T00326                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeh_0161
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_0161
   00052 Galactose metabolism
    Adeh_0161
   00500 Starch and sucrose metabolism
    Adeh_0161
   00520 Amino sugar and nucleotide sugar metabolism
    Adeh_0161
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Adeh_0161
   00524 Butirosin and neomycin biosynthesis
    Adeh_0161
Enzymes [BR:ade01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Adeh_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
184604..185566
Genome map
AA seq 320 aa AA seqDB search
MKGLALGVDLGGTNARAAVVDRATGEIVASHKEPLHERGPEAVVATVVHALGQAAGAAGI
APASAGRVGVGVAGQVLGATGVVMNAPNLGWRDVAFGALLEKALGVPVRVANDLSVAAWG
EKRFGAARGIEDVVLVFVGSGVGSGLILGGRLHDGAQGVAGELGHIKVRLPRPGFTPRRC
GCGQLGCLEAYTSGVNVAARVREEIAAGAATRVLELAEGDLARVTASVVEEAHALGDAYA
VALWDEVSELLGLAVANLVTLLNPARLILGGGVLLGAPRLAALTLRRFDDAVSRSATRGL
TVERAWLGDDAGVIGAAVLE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggggctcgcgctcggcgtggacctcgggggcaccaacgcgcgcgccgcggtggtg
gaccgcgccaccggcgagatcgtcgcctcgcacaaggagccgctgcacgagcgcgggccg
gaggcggtggtcgcgacggtcgtccacgcgctcggccaggcggccggcgccgccgggatc
gcgccggcgtcggcgggccgggtcggggtgggcgtggccgggcaggtgctcggcgccacc
ggcgtggtgatgaacgcgcccaacctgggctggcgcgacgtggcgttcggcgcgctgctg
gagaaggcgctgggcgtgccggtgcgggtcgcgaacgacctgtcggtcgcggcctggggg
gagaagcgcttcggcgccgcccgcggcatcgaggacgtggtgctggtgttcgtcggctcc
ggcgtgggctccgggctcatcctgggcggccggctgcacgacggggcccagggcgtggcc
ggggagctcggccacatcaaggtgcgcctgccgcgcccggggttcacgccccgccgctgc
ggctgcggccagctcggctgcctcgaggcctacacctcgggcgtgaacgtggccgcgcgg
gtccgcgaggagatcgcggccggcgccgccacccgggtgctggagctggcggagggcgac
ctcgcccgcgtcaccgccagcgtggtggaggaggcgcacgcgctgggcgacgcctacgcc
gtggcgctgtgggacgaggtctccgagctgctcggcctcgccgtggcgaacctcgtcacg
ctgctcaaccccgcccggctcatcctgggcggcggcgtgctgctgggcgccccccgcctc
gccgccctgacgctccgccggttcgacgacgcggtatcgcggtcggccacgcgcgggctc
accgtggagcgcgcctggctcggcgacgacgccggggtcatcggcgccgcggtgctcgag
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system