KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0277Help
Entry
Adeh_0277         CDS       T00326                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ade00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Adeh_0277
Enzymes [BR:ade01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Adeh_0277
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Adeh_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
323468..324310
Genome map
AA seq 280 aa AA seqDB search
MPELPEVEIAARNLRRWAEGRRVEEVGWDPRARRIFRPATPAAFARAVEGARFAGIRRIG
KHLLVSLERGGAPVGLLAHLGMTGKWVLRAAGDPAPRHARAWLRLEGDGVLHFQDSRLFG
RLRTVPGARFDEVPEVAALGPDPLEDGIDPAALAGALAASRLPLKVKLLDQRLLPGVGNI
HASEACYRARLDPRRPSRTLSRAGAKALAAGILASFRMTLDAEDGPEITYVEEPGAENPF
LVYAREGEPCPRCRRAGRTSPIRRIVQAQRSTFFCPRCQR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctccccgaggtcgagatcgcggcgcggaacctgcggcgctgggccgagggc
cgccgcgtcgaggaggtcggctgggatccccgcgcgcgccggatcttccgcccggcgacg
ccggccgcgttcgcccgcgcggtggagggcgcccgcttcgccggcatccggcgcatcggc
aagcacctgctcgtctcgctcgagcgcggcggcgcgccggtcgggctgctcgcgcacctg
ggcatgaccggcaagtgggtgctccgcgccgcgggcgatccggcgccgcgccacgcgcgg
gcctggctgcgcctggagggcgacggggtgctgcacttccaggactcgcgcctgttcggc
cggctccgcaccgtgccgggcgcgcgcttcgacgaggtgccggaggtcgcggcgctcggg
ccggatccgctggaggacggcatcgacccggccgcgctcgccggcgcgctcgcggcgagc
cgcctgccgctgaaggtgaagctcctcgaccagcggctcctgcccggcgtcgggaacatc
cacgccagcgaggcctgctaccgggcccgcctcgacccgcgccggccgtcgcgcacgctg
tcgcgcgccggggcgaaggcgctcgccgccggcatcctggcctccttccgcatgacgctc
gacgcggaggacgggccggagatcacctacgtcgaggagcccggggcggagaacccgttc
ctcgtgtacgcgcgcgagggcgagccctgcccgcgctgccggagggcgggccggacctcg
cccatccggcgcatcgtgcaggcgcagcgctccaccttcttctgcccccgctgccagcgg
tag

DBGET integrated database retrieval system