KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0294Help
Entry
Adeh_0294         CDS       T00326                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00500  Starch and sucrose metabolism
ade01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Adeh_0294
Enzymes [BR:ade01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Adeh_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABC80070
UniProt: Q2IMP2
Position
complement(342213..343772)
Genome map
AA seq 519 aa AA seqDB search
MSRQAGVLLPLFSLRSQADWGVGEIPDLVPFARWCADAGFSLALLLPVNEASRGQNSPYG
ALSAFALDPVYLAPSALPDFQAAGGLDALSPDERALLAAVRAAPAVRWDEVRRLKRRALE
IAFARFERDEWSRRTDRARALEAFARQEAGWLDDYALFVALHDEAGGRAWTEWPAPLRDR
DPAALATARARHAREILFQAWVQWQAEEQWRRARAAANGAGVELGGDLPFMVAPDSADVW
ARRGDFRLDARVGVPPDAFSATGQDWGLPVYRWDVMAREGYPWLTARARRMADLFDLYRV
DHVVGLYRTYYFPNDGGPPAFVPSEEGAQIANGERVLGIFSEGARVVAEDLGVVPDFVRA
SLERLRIPGYRVQRWEKNWEAGGNAFRDPARWPPVSVATTGTHDSESVADWYEALSREER
GQLLALPELEPLRGRAPERWDDGVRDALLALVYGAASDLALVPFQDALGMRDRVNVPGTV
TGENWTFRIPMDLGALAADAAARTRLRELAVRAGRAPPG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgccaggcaggcgtcctcctccccctcttctcgctccgctcccaggcagactgg
ggcgtgggcgagatccccgacctcgtccccttcgcgcgctggtgcgccgacgcgggcttc
tcgctggcgctgctcctgccggtgaacgaggcctcgcgggggcagaacagcccgtacggc
gcgctctcggcgttcgcgctcgacccggtgtacctcgcgccctcggcgctccccgacttc
caggccgcgggcggcctcgacgcgctctcgcccgacgagcgcgccctgctcgccgcggtg
cgggccgccccggcggtgcggtgggacgaggtgcgacggctgaagcggcgcgccctcgag
atcgcgttcgcgcgcttcgagcgcgacgagtggagccggcgcaccgaccgcgcccgcgcg
ctggaggcgttcgcgcgccaggaggcgggctggctcgacgactacgcgctgttcgtggcg
ctgcacgacgaggcgggcggccgcgcctggaccgagtggccggcgccgctgcgcgaccgc
gaccccgccgcgctcgccaccgcccgggcccggcacgcgcgggagatcctgttccaggcg
tgggtgcagtggcaggcggaggagcagtggcgccgcgcccgcgccgccgcgaacggcgcc
ggcgtggagctgggcggcgatctcccgttcatggtcgcgccggactcggccgacgtgtgg
gcccgccgcggcgacttccggctcgacgcgcgcgtgggcgtgccgccggacgcgttcagc
gccaccgggcaggactgggggctgccggtctaccgctgggacgtgatggcgcgggagggc
tacccgtggctcaccgcgcgcgcgcgccgcatggccgacctgttcgacctctaccgcgtg
gaccacgtggtgggcctgtaccggacgtactacttccccaacgacggcggcccgccggcg
ttcgtgccgtccgaggagggcgcgcagatcgcgaacggcgagcgcgtgctcgggatcttc
tccgagggcgcgcgggtggtggcggaggacctgggcgtcgtccccgacttcgtgcgcgcc
tcgctggagcggctgcgcatccccggctaccgggtgcagcgctgggagaagaactgggag
gccggcgggaacgcgttccgcgatccggcgcgctggccgccggtgtcggtcgcgaccacc
ggcacgcacgacagcgagtcggtggcggactggtacgaggcgctctcgcgggaggagcgc
ggccagctcctcgcgctgccggagctggagccgctccgcggccgcgccccggagcgctgg
gacgacggcgtgcgcgacgcgctgctggcgctcgtgtacggcgccgcctccgacctcgcg
ctggtgccgttccaggacgcgctcgggatgcgcgaccgggtgaacgtgcccggcacggtc
acgggcgagaactggacgttccggatcccgatggacctgggcgcgctcgcggccgacgcc
gcggcgcggacccggctgcgagagctcgcggtccgggccgggcgagcgccgccggggtag

DBGET integrated database retrieval system