KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0364Help
Entry
Adeh_0364         CDS       T00326                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ade00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ade00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(425291..426559)
Genome map
AA seq 422 aa AA seqDB search
MDKIVIEGGVPLRGSVDVSGAKNAALPVIAAALLAEGEHEVRNVPDLADVRTLGKLLGHM
GCEVVRGEGDRRTVRLRVPAAVTPEAPYELVKTMRASVLVLGPLLARLGRARVSLPGGCA
IGARPIDQHLKALTALGAEIRLEHGYVNASVPGGRLRGTVFTFDAQTVTGTENVMMAAAL
AEGETVLRNCAREPEVKDLGDALVAMGALVEGAGTDEIWIEGVPSLRPLSHAVIPDRIEA
GTFLVAGALPGNDVTVRGCVAAHQEALVEKLRAVGAEVTKVEGGLRVIGDGRPRPVDVRT
APHPGFPTDMQAQLMVLLCLADGTSRITETVFENRFMHVQELIRLGAHVEVDGRVAMVKG
VPELSGAPVMASDLRASAALVLAGLAATGTTEVLRVYHLDRGYERIEEKLAPLGARIRRV
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggacaagatcgtcatcgagggaggcgtcccgctccgcgggagcgtggacgtctccggg
gcgaagaacgccgcgctgcccgtcatcgcggccgcgctgctcgccgagggcgagcacgag
gtgcggaacgtccccgacctcgccgacgtgcgcacgctcggcaagctgctcggccacatg
ggctgcgaggtcgtccgcggcgagggggatcggcgcacggtccggctgcgcgtgccggcg
gcggtgacgcccgaggcgccctacgagctcgtgaagacgatgcgcgcctcggtgctcgtg
ctcgggccgctgctcgcgcgcctcggccgggcgcgcgtgtcgctgcccggcggctgcgcc
atcggcgcccgccccatcgaccagcacctgaaggcgctcaccgcgctcggcgccgagatc
cggctcgagcacggctacgtgaacgccagcgtgcccggcggccgcctccgcggcacggtc
ttcaccttcgacgcccagaccgtcaccggcaccgagaacgtgatgatggcggcggcgctc
gccgagggcgagacggtgctccgcaactgcgcgcgcgagccggaggtgaaggacctcggc
gacgcgctcgtggccatgggcgcgctggtggagggcgccggcaccgacgagatctggatc
gagggcgtcccgtcgctgcggccgctgtcgcacgcggtcatcccggaccgcatcgaggcg
ggcacgttcctggtggcgggcgcgctgcccggcaacgacgtgaccgtccgcggctgcgtc
gcggcgcaccaggaggcgctcgtcgagaagctgcgcgcggtcggcgcggaggtgacgaag
gtcgagggcggcctgcgggtgatcggcgacggccgcccgcgcccggtggacgtgcggacg
gcgccgcaccccgggttccccaccgacatgcaggcgcagctcatggtgctgctctgcctc
gcggacgggacctcgcgcatcaccgagaccgtgttcgagaaccgcttcatgcacgtccag
gagctgatccgcctgggcgcgcacgtcgaggtggacgggcgcgtcgccatggtgaagggg
gtgccggagctgtccggcgcgccggtgatggcgtccgacctgcgggcctcggcggcgctg
gtgctggccggcctcgcggcgaccgggacgaccgaggtgctgcgcgtgtaccatctcgac
cgcggctacgagcggatcgaggagaagctggcgcccctgggggcgcgcatccggagggtg
agaggctga

DBGET integrated database retrieval system