KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0408Help
Entry
Adeh_0408         CDS       T00326                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeh_0408 (fadJ)
   01212 Fatty acid metabolism
    Adeh_0408 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Adeh_0408 (fadJ)
   00650 Butanoate metabolism
    Adeh_0408 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Adeh_0408 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Adeh_0408 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Adeh_0408 (fadJ)
   00310 Lysine degradation
    Adeh_0408 (fadJ)
   00380 Tryptophan metabolism
    Adeh_0408 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Adeh_0408 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Adeh_0408 (fadJ)
   00281 Geraniol degradation
    Adeh_0408 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Adeh_0408 (fadJ)
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Adeh_0408 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Adeh_0408 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Adeh_0408 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
475142..477316
Genome map
AA seq 724 aa AA seqDB search
MMSAEAMTAGQGASRYFRVEVAGGVATLVLDEPGERVNTVHPEAMREFAAHLDRLEKDEA
VKAIVVASGKPDVWVAGAKVELMQGAKDAAEAERLSRDGQALFDRVERCRKPVVAAIHGA
CLGGGLEWALACHYRIATDHPKTSLGLVEVQLGLIPGGGGTQRLSRLIGIQPALDLILAG
KTVKARKALKLGLVDEAVPPPLLLQVAQERAAALASGKLRRAPRRAGGAVERVTRAALEE
NFLGREVLFRQARKLTLAKTKGHYPAPLRALEAVEYGYAKGFEKGLEKEAELFGKLAMTP
EARRLMEIFFATTALKKDNGVDDPAVKARPVSVVGVLGGGLMGGGIAYVTVNAGLPVRLR
ERDDAAAARGVAAVRGVLDERVKRRSIDRLERAEKLRLLTTTTDWSGLERVDVLVEAVFE
DLSLKQEMVRAFEAVNPGGIFASNTSSIPIGRIAEASRHPETVLGMHYFSPVNKMPLLEV
IVTPRTAPEVTATAVALGKKQGKTVIVVRDGPGFYTSRILAPYMNEAAHLLVEGAAIEDL
DHALVAFGFPVGPITLLDEVGIDVGDKVGKILQEAFGARMAPPAALHDVVKAGRLGRKNS
KGFYTYGGKEKRVDETVYDLLPGGRRRKRVAADEIQERLVLQLVNEAVRCLGEGILRSAR
DGDVGAVFGLGFPPFRGGPFRWADAVGTKALLERMEKLRARHGDRFEPAPLLAELGRTGR
PFHG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcggctgaggcgatgacggcgggccagggcgcgtcgcggtacttccgcgtggag
gtcgccggcggggtcgcgacgctggtgctcgacgagccgggcgagcgcgtgaacaccgtg
caccccgaggcgatgcgggagttcgccgcccacctcgaccggctggagaaggacgaggcg
gtgaaggcgatcgtcgtcgcgagcggcaagcccgacgtctgggtggccggcgcgaaggtc
gagctcatgcagggcgcgaaggacgccgccgaggcggagcggctctcgcgcgacgggcag
gcgctgttcgaccgggtggagcgctgccggaagccggtggtggccgccatccacggcgcc
tgcctgggcggcgggctggagtgggcgctcgcctgccactaccggatcgccaccgatcac
ccgaagacgtcgctcggcctcgtcgaggtgcagctcgggctcatccccggcggcggcggg
acgcagcggctctcgcgcctcatcggcatccagccggcgctcgacctcatcctggccggc
aagacggtgaaggcgcgcaaggcgctgaagctcggcctggtggacgaggcggtcccgccg
cccctgctgctgcaggtggcgcaggagcgcgccgccgcgctcgcctcgggcaagctgcgc
cgcgccccgcgccgggcaggcggggcggtggagcgggtcacccgcgccgcgctggaggag
aacttcctcgggcgcgaggtgctgttccgccaggcgcggaagctcacgctcgcgaagacg
aaggggcactacccggcgccgctgcgcgcgctcgaggccgtcgagtacgggtacgcgaag
ggcttcgagaaggggctggagaaggaggcggagctgttcgggaagctcgccatgacgccg
gaggcgcgccggctcatggagatcttcttcgccaccaccgcgctcaagaaggacaacggg
gtggacgaccccgcggtgaaggcgcgcccggtctcggtggtgggcgtgctgggcggcggc
ctgatgggcggcggcatcgcctacgtgaccgtgaacgccgggctcccggtgcgcctgcgc
gagcgggacgacgccgccgcggcgcgaggggtggcggcggtgcgcggcgtcctcgacgag
cgggtgaagcgccggtccatcgaccggctggagcgcgccgagaagctgcgcctcctcacc
acgacgacggactggtccggcctggagcgggtggacgtgctcgtcgaggcggtcttcgag
gacctctcgctgaagcaggagatggtgcgcgcgttcgaggcggtgaacccggggggcatc
ttcgcctccaacacctcgtccatccccatcggccgcatcgccgaggcgtcgcgtcacccc
gagaccgtgctcgggatgcactacttctcgccggtgaacaagatgccgctgctcgaggtg
atcgtcaccccgcgcaccgcgccggaggtgaccgccaccgcggtcgcgctcggcaagaag
caggggaagacggtcatcgtcgtgcgcgacgggcccggcttctacacgagccgcatcctc
gcgccgtacatgaacgaggcggcgcacctgctggtggagggcgcggcgatcgaggacctg
gaccacgcgctggtggcgttcgggttcccggtgggccccatcacgctgctcgacgaggtg
ggcatcgacgtcggcgacaaggtcgggaagatcctgcaggaggcgttcggggcgcgcatg
gcgccgcccgcggcgctgcacgacgtggtgaaggccgggcgcctcggccgcaagaacagc
aagggcttctacacctacggcggcaaggagaagcgcgtggacgagaccgtctacgacctg
ctgcccggcggccgccgccgcaagcgcgtcgccgccgacgagatccaggagcggctggtg
ctgcagctcgtgaacgaggcggtccgctgcctgggcgagggcatcctgcgctcggcccgc
gacggcgacgtcggcgcggtgttcggcctcgggttcccgccgttccgcggcgggccgttc
cgctgggccgacgcggtgggcacgaaggcgctgctcgagcggatggagaagctgcgcgcg
cggcacggcgaccgcttcgagccggcgccgctgctcgccgagctgggccggacgggccgg
ccgttccacggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system