KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0498Help
Entry
Adeh_0498         CDS       T00326                                 

Definition
carbohydrate kinase PfkB
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Adeh_0498
Enzymes [BR:ade01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Adeh_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
588517..589374
Genome map
AA seq 285 aa AA seqDB search
MTPPARPPLRLAVVGHVEHVTIGRVPALPRAGEIAHLQAPRWFPGGGGGVAFWQLARSPA
EVLLFTALGGDEAGAQVERALAASGPRVRVHAARRAGPHTRDLVLLTPDGERTIVVVGEP
LHPRADDALPWGALAGCDAAYFTAQDPAALRAARAARLLVVTARRREALARSGVAADVVV
GSRLDAREVSARADYPVPPGALVLTEGAAGGTIETAAGVERFPAPPSPDGIGGAYGAGDS
FAGALVYLLAAGLPLRDACAAAGRHGAAVLRAVDPRDGQLPLEAP
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgcccgcccgtcccccgctccggctcgccgtggtcggccacgtcgagcacgtc
accatcggccgcgtgccggcgctgccgcgcgccggcgagatcgcgcacctccaggcgccg
cggtggttccccggcggcgggggcggggtggcgttctggcagctcgcccgctcgccggcc
gaggtcctgctgttcaccgcgctcggcggcgacgaggccggcgcgcaggtggagcgggcg
ctcgccgcgagcggaccgcgggtgcgcgtgcacgccgctcgccgggccgggccgcacacc
cgcgacctcgtcctgctcaccccggacggcgagcgcaccatcgtggtggtcggcgagccg
ctccacccgcgcgcggacgacgcgctgccctggggcgcgctggccggctgcgacgccgcg
tacttcaccgcgcaggaccccgccgcgctccgcgccgcccgcgcggcgcgcctgctcgtg
gtgaccgcccgccggcgcgaggcgctggcccggtcgggcgtcgccgccgacgtggtggtg
gggagccgcctcgacgcgcgcgaggtgagcgcgcgcgccgactacccggtgccgcccggc
gcgctggtgctgaccgagggcgccgctggcgggacgatcgagacagccgccggggtggag
cgcttcccggcgccgccctcgcccgacgggatcggcggcgcgtacggcgcgggcgacagc
ttcgccggcgcgctcgtgtacctcctcgcggccgggctgccgctccgcgacgcctgcgcg
gcggcgggccgccacggggcggcggtgctgcgcgcggtggacccgcgcgacggccagctt
ccgctggaggcgccgtga

DBGET integrated database retrieval system