KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0614Help
Entry
Adeh_0614         CDS       T00326                                 

Definition
response regulator receiver (CheY-like) modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ade00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Adeh_0614
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Adeh_0614
Enzymes [BR:ade01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Adeh_0614
Two-component system [BR:ade02022]
 CheA family
  CheA-CheYBV
   Adeh_0614
Bacterial motility proteins [BR:ade02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Adeh_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
708021..709046
Genome map
AA seq 341 aa AA seqDB search
MSLAGGDRPIRVLVADDSELFRELLARVVAAEPGFEVAAVAADGDAAAAMARALRPDVVT
MDLHMPDADGYSGIARIMAETPTPILVLTANPTEAAGFRALSLGALDILEKPSATADLGE
YGRLIRSRLRLLAGVKVIRHLRGLRERRDAAPARAARVEVVVIGASLGGPRALAAVLRGL
PPDFPAPIAVVQHIADGFTAGLAGWLAQESRLDVREARHGDPLRAGRVLIAPSGRHLVLG
EGVARLSDAPPVDTFRPSVTPLFTSAARQYGRRCCGVLLTGMGRDGAEGLRVIKDAGGPT
LAQDEATSAVFGMARAAVELGAVDRVLPVDEIPRALRELTR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcgccgggggggaccggcccatccgcgtgctggtcgccgacgactcggagctg
ttccgcgagctgctcgcgcgcgtcgtcgcggccgagcccggcttcgaggtggcggcggtc
gcggcggacggcgacgcggcggcggccatggcccgcgcgctgcggccggacgtggtcacc
atggacctgcacatgcccgacgccgacggctactcgggcatcgcgcggatcatggcggag
acgcccacgcccatcctggtgctcaccgcgaaccccaccgaggcggcgggcttccgcgcc
ctctcgctgggcgcgctcgacatcctggagaagccgtccgcgaccgccgacctgggcgag
tacggccggctcatccgctcgcggctgcgcctgctcgccggcgtgaaggtgatccggcac
ctgcgcggcctgcgggagcgccgggacgccgcgccggcccgcgccgcgcgcgtcgaggtg
gtggtgatcggcgcctcgctgggcggcccccgcgcgctggcggcggtgctccgcggcctc
ccgcccgacttccccgcgcccatcgcggtggtgcagcacatcgccgacggcttcacggcc
gggctcgccggctggctcgcgcaggagtcgcgcctcgacgtgcgcgaggcccgccacggg
gacccgctgcgggcgggcagggtgctcatcgcgccgagcggccggcacctggtcctcggc
gagggcgtggcgcggctctccgacgcgccgccggtggacaccttccgcccctcggtgacg
ccgctcttcacctccgcggcgcggcagtacgggcgccgctgctgcggcgtgctgctcacc
ggcatgggccgcgacggggccgaggggctgcgggtcatcaaggacgcgggcggccccacg
ctggcgcaggacgaggccaccagcgcggtgttcgggatggcgcgcgccgcggtggagctg
ggcgcggtggaccgcgtgctgccggtggacgagatcccgcgcgcgctccgggagctgacg
cggtga

DBGET integrated database retrieval system