KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0617Help
Entry
Adeh_0617         CDS       T00326                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Adeh_0617
Enzymes [BR:ade01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Adeh_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
711060..712367
Genome map
AA seq 435 aa AA seqDB search
MRAYEIIHAKRDGRPLPADAIAALVDGFTRGEVPDYQMAAFCMAVFFRGMDDGEVRALTE
AMLRSGDVLDLSDIPGAKVDKHSTGGVGDKVSLALAPLAAACGVKVPMISGRGLGHTGGT
LDKLEAIPGFRVDLPVERFRALVREVGACLIGQTARLAPADRKLYALRDVTATVESIPLI
AASIMSKKLAEGIDALVLDVKVGSGAFMKRPEDARALARTLAAIGRGMGKRVTALLTAMD
QPLGRAVGNALEVAEVLELLRGGGPADLRAVTVELTAEMLLAGGVAAELAAARAAVERAI
ADGSGLAKLEEIVAAQGGDVAAIRDPSRLPRAADPYPVPAPAAGFVQAVDTEAVGLAAVA
LGAGRARVEDPVDPAVGILVERKLGDRVERGEPLCLVHHGPRSEPRERIVARLAGAYRIG
PAAPAAAPLFLERMA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgcctacgagatcatccacgcgaagcgcgacggcaggcccctgcccgcggacgcc
atcgcggcgctggtggacgggttcacccgcggcgaggtgcccgactaccagatggcggcg
ttctgcatggccgtgttcttccgcggcatggacgacggcgaggtgcgcgcgctgaccgag
gcgatgctccgctccggcgacgtgctcgacctgtccgacatcccgggcgcgaaggtggac
aagcactccaccggcggcgtgggcgacaaggtctcgctcgcgctcgcgccgctcgcggcg
gcctgcggcgtcaaggtgccgatgatctcggggcgcggcctgggccacaccggcggcacg
ctcgacaagctggaggcgatcccgggcttccgggtggacctgccggtggagcgcttccgc
gcgctggtgcgcgaggtcggcgcctgcctgatcgggcagaccgcgcgcctcgcgccggcg
gaccggaagctgtacgcgctgcgcgacgtgaccgccacggtggagtcgatcccgctcatc
gccgcctcgatcatgtcgaagaagctggccgaggggatcgacgcgctcgtgctcgacgtg
aaggtcggctccggcgcgttcatgaagcggcccgaggacgcgcgcgcgctggcgcgcacg
ctcgccgcgatcgggcgcgggatgggcaagcgcgtcaccgcgctgctcaccgccatggac
cagccgctcggccgggcggtggggaacgcgctggaggtcgccgaggtgctcgagctgctg
cgcggcggcgggccggcggacctgcgcgcggtgacggtcgagctcaccgcggagatgctg
ctcgccggcggggtcgcggcggagctcgccgcggcgcgcgcggcggtggagcgcgccatc
gccgacgggagcgggctcgcgaagctggaggagatcgtggcggcgcagggcggcgacgtc
gccgcgatccgcgacccgtcgcggctgccgcgcgccgcggacccctacccggtccccgcg
cccgccgcgggcttcgtgcaggcggtggacaccgaggcggtggggctcgccgcggtcgcg
ctcggcgccgggcgcgcccgggtggaggaccccgtcgatccggcggtgggcatcctcgtc
gagcggaagctgggcgaccgcgtcgagcggggcgagccgctctgcctcgtccaccacggt
ccgcggagcgagccccgcgagcgcatcgtcgcccggctcgccggcgcgtaccgcatcggc
ccggccgcacccgcggcggcgcccctgttcctcgagaggatggcatga

DBGET integrated database retrieval system