KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0712Help
Entry
Adeh_0712         CDS       T00326                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Adeh_0712 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Adeh_0712 (hisD)
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Adeh_0712 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
827119..828513
Genome map
AA seq 464 aa AA seqDB search
MLKLDSRDPGFPEAWARVCARGSDEDEAPVREAAAAIVADVRARGDLALLEHTRRHDAWE
PGSAAGLALGPADFAAAYRGLPAAARRALSLAARRIADFHRRESDARVPARRDALGATLS
QVVRPLERVGLYVPGGTARYPSSVLMTAVPARVAGVREIVVTSPGVKGTGEMDRWTLAAC
HVAGVARLFKVGGAQAVAALAYGTATVPAVDKICGPGNAYVAAAKRLVFGRVDIDMIAGP
SEILVLADAAADPAEVASDLLAQAEHDVRAVSVLVTPSAALARAALAEVERQLAGLPRRE
IAGRSIEERGAVVVTRGLSEAVRLADAFAPEHLALHARGAAALVKRISRAGAVFVGSSTP
EAVGDYLAGPSHVLPTAGTARFASPLSVATFRRRMSVLDLTPAALAALAPSVEALARAEG
LEGHWRAVEVRVAKRAPARRGRAARTAKAARASRARPARSGARR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaagctcgattcccgcgatcctggcttccccgaagcatgggcccgcgtctgcgcc
cgcgggtcggacgaggacgaggcgccggtgcgcgaggccgccgccgccatcgtcgcggac
gtccgcgcccgcggcgacctggcgctgctcgagcacacccgccgtcacgacgcctgggag
ccgggctcggccgccggcctggcgctcggccccgccgacttcgccgccgcctaccgcggc
ctccccgccgcggcgcggcgcgcgctctcgctcgccgcccggcgcatcgccgacttccac
cggcgcgagtccgacgcccgggtgccggcgcgccgcgacgcgctgggcgcgacgctgtct
caggtggtccggccgctggagcgcgtcggcctctacgttccgggggggaccgcccgctat
ccctcctccgtgctgatgaccgccgtgccggcccgcgtcgccggcgtgcgcgagatcgtc
gtcacgtcaccaggcgtgaagggtaccggcgagatggaccgctggacgctcgccgcctgc
cacgtggccggggtggcgcggctgttcaaggtcggcggcgcgcaggcggtggcggcgctc
gcctacggcaccgccacggtgcctgcggtggacaagatctgcgggccgggcaacgcgtac
gtggccgccgcgaagcggctggtgttcgggcgcgtggacatcgacatgatcgccgggccg
agcgagatcctggtgctcgccgacgccgcggcggatccggccgaggtcgcgagcgacctg
ctcgcgcaggccgagcacgacgtgcgcgcggtctcggtgctggtgacgccgtcggccgcg
ctggcgcgggcggcgctggccgaggtcgagcggcagctcgccggcttgccgcggcgcgag
atcgccgggcggtcgatcgaggagcgcggcgcggtggtggtgacgcgcggcctctccgag
gcggtgcggctcgccgacgcgttcgcgcccgagcacctggcgctgcacgcgcgcggcgcc
gcggccctcgtgaagcggatctcgcgcgccggcgcggtgttcgtgggcagctccacgccg
gaggcggtgggcgactacctggccggcccgagccacgtgctcccgaccgccggcaccgcc
cggttcgcctcgccgctctcggtggcgacgttccgccgccgcatgagcgtgctcgacctg
acgcccgcggcgctcgccgcgctggcgccgtcggtcgaggcgctggcgcgggcggagggg
ctggaggggcactggcgcgcggtggaggtgcgggtcgcgaagcgcgcgccggcgcggcgc
ggccgggcggcgcggaccgcgaaggccgcgcgggcctcgagggcgcgccccgcgcgcagc
ggggcgcggcgatga

DBGET integrated database retrieval system