KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0782Help
Entry
Adeh_0782         CDS       T00326                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00020  Citrate cycle (TCA cycle)
ade00310  Lysine degradation
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01130  Biosynthesis of antibiotics
ade01200  Carbon metabolism
Module
ade_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ade_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Adeh_0782
  Amino acid metabolism
   00310 Lysine degradation
    Adeh_0782
Enzymes [BR:ade01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Adeh_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABC80557
UniProt: Q2IP23
Position
902685..903956
Genome map
AA seq 423 aa AA seqDB search
MSIQLKVPNIGESVQTATIGTWLKKEGEPVQADEPVVEVESEKATVAVPAPAAGVLRKVL
RQSGDTVAIGEVIAELDEGGAGQAAGASPFGSGPVPGGTVPAARGDGAPAPAPAAAPAPA
AAPPARAAPPAPTPAAPPAPAAPAGFRAPPSARRMMAELGVTPEQVIRKEDVARALETRP
AAPAAPAVAGPRERVVAMTPLRRTVARRLVEAQHTAALLTTFNEVDMSRVLALREQHGEA
FLKKHGVKLGFMSFFVKASIEALRAYPGVNGEIRGDSIVYKDHYDVGVAVGGGKGLVVPV
VRDADALSFAEVETTIGELAKKAKENRITLEELAGGTFTISNGGIYGSMLSTPIINPPQS
GILGLHKIQKRAVVDADDQVVVRPMMYLALSYDHRLVDGREAVSFLVKVKECIEDPERML
LEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccagctcaaggtcccgaacatcggcgaatccgtgcagacggccaccatcggc
acgtggctcaagaaggagggcgagccggtccaggccgacgagcccgtcgtggaggtggag
agcgagaaggccaccgtggcggtcccggcgcccgccgccggcgtgctgcgcaaggtgctc
cggcagtccggcgacaccgtcgcgatcggcgaggtgatcgcggagctggacgagggcggc
gccggccaggccgcgggcgcctcgccgttcggctccggcccggtgcccggcggcaccgtc
cccgccgcccggggcgacggcgccccggcccccgcccccgcagccgcgccggccccggcg
gccgccccgcccgcgcgcgccgctcccccggcgcccacgcccgccgcgccgccggcgccg
gccgcgcccgccggcttccgcgccccgccctccgcccggcgaatgatggccgagctgggc
gtgacgccggagcaggtgatccgcaaggaggacgtggcccgcgcgctcgagacgcgcccg
gccgcgcccgcggccccggcggtggccggcccccgcgagcgcgtggtcgcgatgaccccg
ctgcgccgcaccgtggcgcgccggctggtggaggcgcagcacaccgcggcgctgctcacc
accttcaacgaggtggacatgtcgcgcgtgctcgcgctccgcgagcagcacggcgaggcc
ttcctgaagaagcacggggtgaagctcggcttcatgtcgttcttcgtgaaggcgtccatc
gaggcgctgcgcgcctaccccggcgtgaacggcgagatccgcggcgacagcatcgtctac
aaggaccactacgacgtcggcgtggcggtcggcggcggcaagggcctggtggtcccggtg
gtccgcgacgccgacgcgctctccttcgccgaggtggagaccaccatcggcgagctggcg
aagaaggcgaaggagaaccgcatcacgctcgaggagctggccggcggcaccttcaccatc
tccaacggcggcatctacgggtcgatgctctccacgcccatcatcaacccgccgcagtcc
ggcatcctcggcctgcacaagatccagaagcgcgcggtggtggacgcggacgaccaggtg
gtggtccggccgatgatgtacctggcgctctcgtacgaccaccggctggtggacggccgc
gaggcggtctccttcctcgtgaaggtgaaggagtgcatcgaggatccggagcggatgctg
ctggaggtgtga

DBGET integrated database retrieval system