KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0782Help
Entry
Adeh_0782         CDS       T00326                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeh_0782
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Adeh_0782
  Amino acid metabolism
   00310 Lysine degradation
    Adeh_0782
Enzymes [BR:ade01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Adeh_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
902685..903956
Genome map
AA seq 423 aa AA seqDB search
MSIQLKVPNIGESVQTATIGTWLKKEGEPVQADEPVVEVESEKATVAVPAPAAGVLRKVL
RQSGDTVAIGEVIAELDEGGAGQAAGASPFGSGPVPGGTVPAARGDGAPAPAPAAAPAPA
AAPPARAAPPAPTPAAPPAPAAPAGFRAPPSARRMMAELGVTPEQVIRKEDVARALETRP
AAPAAPAVAGPRERVVAMTPLRRTVARRLVEAQHTAALLTTFNEVDMSRVLALREQHGEA
FLKKHGVKLGFMSFFVKASIEALRAYPGVNGEIRGDSIVYKDHYDVGVAVGGGKGLVVPV
VRDADALSFAEVETTIGELAKKAKENRITLEELAGGTFTISNGGIYGSMLSTPIINPPQS
GILGLHKIQKRAVVDADDQVVVRPMMYLALSYDHRLVDGREAVSFLVKVKECIEDPERML
LEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccagctcaaggtcccgaacatcggcgaatccgtgcagacggccaccatcggc
acgtggctcaagaaggagggcgagccggtccaggccgacgagcccgtcgtggaggtggag
agcgagaaggccaccgtggcggtcccggcgcccgccgccggcgtgctgcgcaaggtgctc
cggcagtccggcgacaccgtcgcgatcggcgaggtgatcgcggagctggacgagggcggc
gccggccaggccgcgggcgcctcgccgttcggctccggcccggtgcccggcggcaccgtc
cccgccgcccggggcgacggcgccccggcccccgcccccgcagccgcgccggccccggcg
gccgccccgcccgcgcgcgccgctcccccggcgcccacgcccgccgcgccgccggcgccg
gccgcgcccgccggcttccgcgccccgccctccgcccggcgaatgatggccgagctgggc
gtgacgccggagcaggtgatccgcaaggaggacgtggcccgcgcgctcgagacgcgcccg
gccgcgcccgcggccccggcggtggccggcccccgcgagcgcgtggtcgcgatgaccccg
ctgcgccgcaccgtggcgcgccggctggtggaggcgcagcacaccgcggcgctgctcacc
accttcaacgaggtggacatgtcgcgcgtgctcgcgctccgcgagcagcacggcgaggcc
ttcctgaagaagcacggggtgaagctcggcttcatgtcgttcttcgtgaaggcgtccatc
gaggcgctgcgcgcctaccccggcgtgaacggcgagatccgcggcgacagcatcgtctac
aaggaccactacgacgtcggcgtggcggtcggcggcggcaagggcctggtggtcccggtg
gtccgcgacgccgacgcgctctccttcgccgaggtggagaccaccatcggcgagctggcg
aagaaggcgaaggagaaccgcatcacgctcgaggagctggccggcggcaccttcaccatc
tccaacggcggcatctacgggtcgatgctctccacgcccatcatcaacccgccgcagtcc
ggcatcctcggcctgcacaagatccagaagcgcgcggtggtggacgcggacgaccaggtg
gtggtccggccgatgatgtacctggcgctctcgtacgaccaccggctggtggacggccgc
gaggcggtctccttcctcgtgaaggtgaaggagtgcatcgaggatccggagcggatgctg
ctggaggtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system