KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0782Help
Entry
Adeh_0782         CDS       T00326                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeh_0782
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Adeh_0782
  Amino acid metabolism
   00310 Lysine degradation
    Adeh_0782
Enzymes [BR:ade01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Adeh_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
902685..903956
Genome map
AA seq 423 aa AA seqDB search
MSIQLKVPNIGESVQTATIGTWLKKEGEPVQADEPVVEVESEKATVAVPAPAAGVLRKVL
RQSGDTVAIGEVIAELDEGGAGQAAGASPFGSGPVPGGTVPAARGDGAPAPAPAAAPAPA
AAPPARAAPPAPTPAAPPAPAAPAGFRAPPSARRMMAELGVTPEQVIRKEDVARALETRP
AAPAAPAVAGPRERVVAMTPLRRTVARRLVEAQHTAALLTTFNEVDMSRVLALREQHGEA
FLKKHGVKLGFMSFFVKASIEALRAYPGVNGEIRGDSIVYKDHYDVGVAVGGGKGLVVPV
VRDADALSFAEVETTIGELAKKAKENRITLEELAGGTFTISNGGIYGSMLSTPIINPPQS
GILGLHKIQKRAVVDADDQVVVRPMMYLALSYDHRLVDGREAVSFLVKVKECIEDPERML
LEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccagctcaaggtcccgaacatcggcgaatccgtgcagacggccaccatcggc
acgtggctcaagaaggagggcgagccggtccaggccgacgagcccgtcgtggaggtggag
agcgagaaggccaccgtggcggtcccggcgcccgccgccggcgtgctgcgcaaggtgctc
cggcagtccggcgacaccgtcgcgatcggcgaggtgatcgcggagctggacgagggcggc
gccggccaggccgcgggcgcctcgccgttcggctccggcccggtgcccggcggcaccgtc
cccgccgcccggggcgacggcgccccggcccccgcccccgcagccgcgccggccccggcg
gccgccccgcccgcgcgcgccgctcccccggcgcccacgcccgccgcgccgccggcgccg
gccgcgcccgccggcttccgcgccccgccctccgcccggcgaatgatggccgagctgggc
gtgacgccggagcaggtgatccgcaaggaggacgtggcccgcgcgctcgagacgcgcccg
gccgcgcccgcggccccggcggtggccggcccccgcgagcgcgtggtcgcgatgaccccg
ctgcgccgcaccgtggcgcgccggctggtggaggcgcagcacaccgcggcgctgctcacc
accttcaacgaggtggacatgtcgcgcgtgctcgcgctccgcgagcagcacggcgaggcc
ttcctgaagaagcacggggtgaagctcggcttcatgtcgttcttcgtgaaggcgtccatc
gaggcgctgcgcgcctaccccggcgtgaacggcgagatccgcggcgacagcatcgtctac
aaggaccactacgacgtcggcgtggcggtcggcggcggcaagggcctggtggtcccggtg
gtccgcgacgccgacgcgctctccttcgccgaggtggagaccaccatcggcgagctggcg
aagaaggcgaaggagaaccgcatcacgctcgaggagctggccggcggcaccttcaccatc
tccaacggcggcatctacgggtcgatgctctccacgcccatcatcaacccgccgcagtcc
ggcatcctcggcctgcacaagatccagaagcgcgcggtggtggacgcggacgaccaggtg
gtggtccggccgatgatgtacctggcgctctcgtacgaccaccggctggtggacggccgc
gaggcggtctccttcctcgtgaaggtgaaggagtgcatcgaggatccggagcggatgctg
ctggaggtgtga

DBGET integrated database retrieval system