KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0952Help
Entry
Adeh_0952         CDS       T00326                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ade00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Adeh_0952
Enzymes [BR:ade01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Adeh_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1101566..1102159
Genome map
AA seq 197 aa AA seqDB search
MIARLAGRIAEKRDDHAIVDVGGVGYLVHVSQLSLASLPPPGEPAALRVYTHVREDALDL
YGFATEDEEAVFRALIDVKGVGPRAAQNILSGIEARELAQAVAQGDVARLTKVQGIGKKT
AERLVVELKDKLVALARAAGPARAGAEADVLDQLRTALLNLGYRPPQAEGVAEALRDSAE
GRPLDELLREALKRLRG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgcgcctggccgggcggatcgccgagaagcgcgacgaccacgccatcgtggac
gtgggcggggtcggctacctcgtgcacgtctcgcagctctcgctggcctcgctcccgccg
cccggcgagcccgccgcgctccgcgtctacacccacgtccgcgaggacgcgctcgacctg
tacggcttcgccaccgaggacgaggaggcggtgttccgcgccctcatcgacgtgaagggc
gtgggcccgcgggcggcgcagaacatcctctccggcatcgaggcgcgcgagctggcgcag
gcggtggcgcagggcgacgtggcccggctcaccaaggtccagggcatcgggaagaagacc
gccgagcggctggtggtggagctgaaggacaagctggtggcgctggcgcgcgccgccggg
cccgcccgcgccggcgcggaggcggacgtgctcgatcagctccggaccgccctgctcaac
ctgggctaccggccgccgcaggccgagggcgtggcggaggcgctgcgcgactcggccgag
ggccgcccgctcgacgagctcctgcgcgaggcgctgaagcggctgcgcgggtag

DBGET integrated database retrieval system