KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0981Help
Entry
Adeh_0981         CDS       T00326                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Adeh_0981
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Adeh_0981
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Adeh_0981
Enzymes [BR:ade01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Adeh_0981
Exosome [BR:ade04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Adeh_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1129384..1130799)
Genome map
AA seq 471 aa AA seqDB search
MHARNLIAALALALALAAGDALAAGPAKNVIFFLGDGMGPTTVTAARIFAHGEAGALAID
GLGRTARVKTFSANAQTTDSAPSMSAYMTGVKMNNEVVSMSAETSAADLSVTPPAAYVSG
ASSTCPETGNGTPVTTLLELAKAAGKAVGAVTTTRVTHATPAATFAHLCHRDGENTIAEQ
VTPGHPRFNPALGAGVDVLLGGGWRHFVPSTTTGSKRTDATDLTALFTGAGYTYVTTGSA
LAAVDPAATTRLLGLFNRDHLSYELDRVAAAADEPSLADMTEKAIRVLRKDGDGFFLMVE
GGRIDHALHGTNARRALEDTVAFDDAIARALTLVDPADTLVVVTADHDHTLAFNGYAHRG
NPVLGLSTDLKQTTVTGAPVPALAADGRPYTTLVFGNGGTPRTADRADPSLADTTAPDYL
QDVGVQLGTPGSETHGGGDVMLFAKGAGSAGFKGTIDNTRVFGLVRAAMGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcacgcaacctcatcgcggcgctcgcgctcgcgctcgcgctcgccgccggcgac
gccctcgccgccggcccggccaagaacgtcatcttcttcctcggcgacgggatgggcccc
accaccgtcaccgcggcccgcatcttcgcgcacggcgaggccggcgccctggccatcgac
ggcctcggccgcacggcccgggtgaagaccttctccgcgaacgcccagaccaccgacagc
gcgccgtccatgtcggcgtacatgacgggcgtgaagatgaacaacgaggtggtctcgatg
tcggcggagacctccgcggccgacctgtcggtcaccccgccggccgcgtacgtctccggc
gcgagctccacctgccccgagacggggaacggcacgcccgtgaccacgctgctcgagctc
gccaaggccgccggcaaggcggtcggcgcggtgaccaccacgcgcgtcacccacgcgacc
ccggccgcgacgttcgcgcacctctgccaccgcgacggcgagaacaccatcgcggagcag
gtcaccccggggcacccgcgcttcaaccccgcgctcggcgccggcgtggacgtgctgctc
ggcggcggctggcggcacttcgtcccgagcaccaccaccggcagcaagcggaccgacgcg
accgacctcaccgcgctgttcaccggggccggctacacgtacgtgaccaccggcagcgcg
ctcgccgccgtggatcccgccgccaccacccgcctgctcgggctgttcaaccgcgatcac
ctgtcctacgagctggaccgcgtcgcggcggcggccgacgagcccagcctcgccgacatg
accgagaaggcgatccgcgtcctccggaaggacggcgacggcttcttcctgatggtcgag
ggcggccgcatcgaccacgcgctccacgggacgaacgcgcggcgcgcgctcgaggacacc
gtggcgttcgacgacgccatcgcgcgggcgctcacgctggtggacccggcggacacgctc
gtcgtggtcaccgccgaccacgaccacacgctcgcgttcaacgggtacgcgcaccgcggc
aacccggtgctcggcctctccaccgacctcaagcagaccacggtgaccggcgcgcccgtc
ccggcgctcgccgccgacggccggccgtacaccacgctggtgttcggcaacggcggcacg
ccccggaccgccgaccgcgccgaccccagcctggccgacaccaccgcccccgactacctg
caggacgtgggcgtccagctcggcacccccggctccgagacgcacggcggcggcgacgtg
atgctgttcgcgaagggcgccggcagcgccgggttcaaggggacgatcgacaacacgcgc
gtgttcgggctggtgcgcgcggcgatggggctgtag

DBGET integrated database retrieval system