KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1164Help
Entry
Adeh_1164         CDS       T00326                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1337796..1338818)
Genome map
AA seq 340 aa AA seqDB search
MNLLVTGGTGFLGAALVPLLARAGHRLRLLQRSAAPEAEALGADVRRAALEDAEAVRAAL
DGVDAVFHLAGQVDFDPAEPARLYELHVQGTRRLLEACVAAGVRRVILASTSGTIAVSKE
ERVATEADPYPIAAVAGWPYYLSKIFQEKAALRIHRDTGLPVVVLNPSLLLGPGDTRLSS
TDVVFKFLERRIPAMPSGGLSFVDVRDAARAFAAALERGRPGERYLLGGANLSFRDFFGR
LERLSGVPAPRLALPGGLNVAGARLLEKLSGWRGAEAPIDAPSVEMGEHFWYCDSRKAEE
ALGFSARDPQETLFETVRWLEQHVRPRKAPETVAELLRGR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctgctcgtcaccggcggcaccgggttcctcggcgccgcgctcgtcccgctgctc
gcgcgggccggccaccgcctccggctgctgcagcgctcggccgcgccggaggccgaggcg
ctcggcgccgacgtgcgccgcgccgcgctcgaggacgccgaggcggtccgggcggcgctc
gacggcgtggacgcggtgttccacctggccgggcaggtggacttcgatccggccgagccg
gcgcgcctgtacgagctgcacgtgcagggcacgcggcggctgctggaggcgtgcgtcgcc
gcgggcgtgcggcgggtgatcctcgcctccacctccggcaccatcgccgtctcgaaggag
gagcgggtcgccaccgaggccgacccctaccccatcgccgcggtggcgggctggccctac
tacctctccaagatcttccaggagaaggcggcgctccggatccaccgcgacaccgggctc
ccggtggtggtgctgaacccgtcgctcctgctcggcccgggcgacacccgcctctcctcc
accgacgtcgtcttcaagttcctggagcggcgcatcccggccatgcccagcggcgggctc
tccttcgtggacgtgcgcgacgcggcccgcgcgttcgcggcggcgctcgagcgcgggcgg
cccggcgagcgctacctgctcggcggcgcgaacctgagcttccgcgacttcttcggccgg
ctggagcggctctcgggcgtgcccgcgccgcggctggcgctgcccggcggcctgaacgtc
gccggggcgcggctcctcgagaagctctccgggtggcgcggcgccgaggcgcccatcgac
gcgccctcggtcgagatgggcgagcacttctggtactgcgactcgcgcaaggcggaggag
gcgctcgggttctcggcgcgcgatccgcaggagacgctgttcgagaccgtgcggtggctg
gagcagcacgtccggccccgcaaggcgccggagacggtggccgagctgctccgcgggcgc
tga

DBGET integrated database retrieval system