KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1303Help
Entry
Adeh_1303         CDS       T00326                                 

Definition
DNA replication and repair protein RecO
Orthology
K03584  
DNA repair protein RecO (recombination protein O)
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ade03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1507450..1508214
Genome map
AA seq 254 aa AA seqDB search
MDRVKLTGVVLRAVDYGESDRVVTLLTAERGKVSAFARGARASRRRFGGALEPFTLLSAE
VRERSGSDLLGLDSVSVVRGFGALRGDLGRIACAGYAAELARELVRDHQPHDELFDLLVA
YLGALDAAPPRPAALRAFELGALRAAGLMPRLDACARCGAPVGEGPVRFDAGEGGALCGG
CAPGVPRTLPLAAGTLAALLRLQEGGLAAAASEPLAAPAGREAREALTAFLEHHLGRRLA
ARRFLDEIGPLLGG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgtgaagctcaccggcgtggtgctccgcgccgtggactacggcgagtcggat
cgcgtggtgacgctgctcaccgcggagcggggcaaggtctccgcgttcgcgcgcggcgcg
cgggcctcgcggcgccgcttcggcggcgcgctggagccgttcacgctgctctcggcggag
gtccgcgagcgctccggctcggacctcctcggcctggactcggtctcggtggtgcgcggc
ttcggcgcgctccgcggcgacctcgggcggatcgcctgcgccggctacgcggccgagctg
gcgcgcgagctggtgcgcgaccaccagccccacgacgagctcttcgacctgctggtcgcc
tacctcggcgcgctggacgccgcgccgccgcggccggcggcgctgcgcgccttcgagctg
ggcgcgctgcgcgccgccgggctcatgccgcgcctcgacgcctgcgcgcgctgcggggcg
ccggtgggcgaggggccggtgcgcttcgacgcgggggagggcggcgcgctctgcggcggc
tgcgcgccgggcgtcccgcgcacgctcccgctcgcggccggcacgctcgccgcgctcctg
cggctccaggagggcggcctcgccgccgccgcgtccgagccgctggccgcgcccgccggg
cgcgaggcgcgcgaggcgctcaccgcgttcctggagcaccacctcggccggcggctcgcc
gcccgccgcttcctcgacgagatcgggccgctgctgggcgggtga

DBGET integrated database retrieval system