KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1318Help
Entry
Adeh_1318         CDS       T00326                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Adeh_1318
Enzymes [BR:ade01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Adeh_1318
    3.5.1.-  
     Adeh_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1528746..1529387
Genome map
AA seq 213 aa AA seqDB search
MRIDRASDALLVVDLQHDFLPGGALGVADGDRVVEPLARLAPAFSTVVATQDWHPPGHVS
FASTHPGQAPYASIPLAHGPQELWPDHCVRGTRGAALHPALPDAAVTLVLRKGTRREVDS
YSAFRENVGPDGRRPTTGLGAWLSARGVRRVFLGGLARDFCVRVSAVDAAAEGFEVVVLD
DLTRAVFPERREAVDRELAAAGARLALSGDLIR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgatcgcgcgtcggatgcgctcctggtggtggacctccagcacgacttcctg
cccggcggcgcgctcggcgtcgccgacggcgaccgggtcgtggagccgctggcgcgcctg
gcgcccgcgttctcgaccgtggtggcgacgcaggactggcacccgcccggccacgtgtcc
ttcgcctccacgcacccgggccaggcgccctacgcgtcgatcccgctggcgcacggcccg
caggagctctggccggaccactgcgtccgcggcacgcggggcgccgcgctgcacccggcg
ctcccggacgccgcggtcacgctggtgctgcgcaagggcacgcggcgcgaggtggactcc
tacagcgccttccgcgagaacgtcgggccggacggccggcgcccgaccaccgggctgggc
gcctggctctcggcccgcggcgtgcgccgggtgttcctgggcgggctggcgcgcgacttc
tgcgtgcgcgtgtccgcggtggacgcggccgccgaggggttcgaggtggtggtgctcgac
gacctcacgcgggcggtgttcccggagcggcgggaagcggtggaccgcgagctcgccgcg
gcgggcgcgcgcctggcgctgagcggggacctgatccgctga

DBGET integrated database retrieval system