KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1418Help
Entry
Adeh_1418         CDS       T00326                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Adeh_1418
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_1418
  Lipid metabolism
   00071 Fatty acid degradation
    Adeh_1418
  Amino acid metabolism
   00350 Tyrosine metabolism
    Adeh_1418
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Adeh_1418
   00626 Naphthalene degradation
    Adeh_1418
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Adeh_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1630282..1631265)
Genome map
AA seq 327 aa AA seqDB search
MRAMVLVRPGAPLAAAELPDPVPGPGELRLRVGACGVCRTDLHVADGELPDPKLPLVLGH
EIVGRVDRVGPGVTRFKAGDRIGVPWLGWTCGRCAACRSGRENLCSAARFTGYHLDGGYA
ELAVADARYAFAIPGDYEDADAAPLLCAGLIGHRAWAPVRGAQRLGLYGFGAAAHLVVQL
ARHAGQRVFAFTRAGDAEAQAFALQLGAEWAGASGEVPPEPLDAAILFAPVGALVPIALR
DVVPGGTVVCAGIHMSDIPSFPYALLWGERTLRSVANLTRADGDALLALAPEVPLRTEVV
PYPLERANDALADLRAGRLRGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatggtcctcgtccgccccggcgccccgctcgccgcggcggagctccccgat
cccgtccccggccccggcgagctccggctgcgcgtcggcgcctgcggcgtgtgccggacc
gacctgcacgtcgccgacggcgagctgccggacccgaagctgccgctggtgctcggccac
gagatcgtggggcgggtggatcgggtcgggcccggcgtcacccggttcaaggccggcgac
cggatcggcgtgccgtggctcggctggacgtgcggccgctgcgcggcctgccggagcggc
cgcgagaacctgtgcagcgcggcgcggttcaccggctaccacctcgacggcggctacgcc
gagctggcggtggcggacgcgcgctacgcgttcgccatcccgggcgactacgaggacgcg
gacgcggcgcctctgctctgcgccggcctcatcgggcaccgcgcctgggcgccggtgcgc
ggcgcgcagcggctcggcctctacggcttcggggccgcggcgcacctggtggtgcagctc
gcgcggcacgccgggcagcgcgtcttcgcgttcacccgcgccggggacgcggaggcgcag
gcgttcgcgctgcagctcggggccgagtgggccggcgcctcgggcgaggtgccgccggag
ccgctcgacgcggccatcctgttcgcgccggtgggcgcgctcgtccccatcgcgctgcgc
gacgtggtgcccggcggcacggtggtctgcgcgggcatccacatgagcgacatcccctcc
ttcccgtacgcgctgctctggggcgagcggacgctccgctcggtcgcgaacctcacccgc
gccgacggggacgcgctgctcgcgctcgcgcccgaggtcccgctccgcaccgaggtcgtc
ccgtatccgctggagcgggccaacgacgcgctcgcggacctccgcgccggcaggctgcgg
ggggcggcggtgctggtgccgtga

DBGET integrated database retrieval system