KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1496Help
Entry
Adeh_1496         CDS       T00326                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ade00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1723252..1724103
Genome map
AA seq 283 aa AA seqDB search
MRMRIGARLFDGPGPFVMGIVNATPDSFSDGGRFLERDAAVAHALRLADEGADLVDVGGE
STRPGAPPVTAEEELRRVVPVIAALRARGFALPISVDTWKARVAREALAAGADLVNDVTG
LGDPEMAGVVAAAGVPIVLQHMRGTFADMASRAVYADVVGEVTAELAAALARAEAAGIPR
DRVVLDPGLGFAKDARHSLELLARLGELRRLGCPLLVGPSRKSFIGKITGAPAAERLPGT
LAAVTACVLAGVELVRVHDVAAARQAADVAAAIRGAARGAGPL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgcggatcggggccaggctcttcgacgggcctggccccttcgtcatggggatc
gtgaacgcgacccccgactcgttctcggacggcggccggttcctcgagcgcgacgcggcg
gtggcgcacgcgctgcggctcgcggacgagggcgccgacctggtggacgtgggcggcgag
tccacccggcccggcgcgccgccggtgaccgccgaggaggagctgcggcgggtggtgccg
gtgatcgccgcgctgcgcgcgcgcgggttcgcgctcccgatctcggtggacacctggaag
gcgcgggtggcgcgcgaggcgctcgcggccggcgcggacctggtgaacgacgtgaccggc
ctcggcgacccggagatggcgggcgtggtcgccgcggccggcgtgccgatcgtgctccag
cacatgcgcggcacgttcgccgacatggcctcgcgcgcggtgtacgcggacgtggtcggc
gaggtcaccgccgagctggccgccgcgctggcccgggccgaggcggccggcatcccgcgc
gaccgcgtggtgctcgaccccgggctcggcttcgcgaaggacgcccggcacagcctggag
ctgctggcgcggctcggcgagctccggcggctcgggtgcccgctgctggtggggccctcg
cgcaagagcttcatcgggaagatcaccggggcgcccgcggcggagcgcctgcccggtacg
ctcgcggcggtgaccgcgtgcgtgctggccggcgtggagctggtgcgcgtccacgacgtc
gcggccgcgcggcaggcggccgacgtcgccgccgcgatccggggagcggcgcgcggcgcc
ggtccgctgtag

DBGET integrated database retrieval system