KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1532Help
Entry
Adeh_1532         CDS       T00326                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeh_1532 (tpiA)
   01230 Biosynthesis of amino acids
    Adeh_1532 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_1532 (tpiA)
   00051 Fructose and mannose metabolism
    Adeh_1532 (tpiA)
   00562 Inositol phosphate metabolism
    Adeh_1532 (tpiA)
Enzymes [BR:ade01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Adeh_1532 (tpiA)
Exosome [BR:ade04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Adeh_1532 (tpiA)
  Exosomal proteins of bladder cancer cells
   Adeh_1532 (tpiA)
  Exosomal proteins of melanoma cells
   Adeh_1532 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1757746..1758507
Genome map
AA seq 253 aa AA seqDB search
MARTKFVCGNWKMHKTVAEAAQLVKELAAGLGEAAGKVQVAVAPPFTAIHAAAQAAAGSA
IEVAGQDVHWEAQGAFTGEVSAAMLAEAGCRHGIVGHSERRQLFGETDEAVRKKVGALLG
AGLAPIVCVGETLAEREAGRTLEVVDRQVRQGLAGLDAGALGRVTIAYEPVWAIGTGKTA
TSAQAQEVHAAIRKILREMGGSVADAIRIQYGGSVKPENARELMSQPDVDGALVGGASLK
ANDFVAIVKGALR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcaccaagttcgtctgcggcaactggaagatgcacaagaccgtggccgaggcg
gcccagctcgtgaaggagctggccgccgggctcggcgaggccgcgggcaaggtgcaggtg
gcggtcgcgccgcccttcaccgcgatccacgccgccgcccaggcggcggccggctcggcg
atcgaggtcgccgggcaggacgtgcactgggaggcccagggcgcgttcaccggcgaggtg
tccgccgcgatgctggcggaggcgggctgccggcacggcatcgtgggccacagcgagcgg
cgccagctgttcggcgagaccgacgaggccgtccgcaagaaggtcggcgcgctgctcggc
gccgggctcgcgcccatcgtctgcgtgggcgagacgctcgccgagcgcgaggccggccgg
acgctcgaggtcgtggaccggcaggtgcggcaggggctcgccgggctggacgccggggcg
ctgggccgggtgacgatcgcctacgagccggtgtgggccatcggcaccggcaagaccgcc
acctccgcgcaggcgcaggaggtccacgcggccatccggaagatcctccgcgagatgggg
ggttccgtggcggacgcgatccggattcaatacggcggctcggtgaagcccgagaacgcc
cgggaactcatgtcccagcccgacgtggacggcgcgctcgtcggcggggccagcctcaag
gcgaacgatttcgtcgccatcgtgaaaggtgcactccgttga

DBGET integrated database retrieval system