KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1618Help
Entry
Adeh_1618         CDS       T00326                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ade00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ade00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1857168..1858109
Genome map
AA seq 313 aa AA seqDB search
MIGRHKHCIALEDFSREEILEVIDLAVSMKEVLQRPIKKVPSLRGKMVVNLFFEASTRTR
SSFETAAKILSADALNWTSSSSSVTKGETLVDTAKNLEAMRPDVLVIRHSAGGAPRLVAE
HVGCSVVSAGDGAHEHPSQGLLDCFTLREKLGTLEGKTVAIVGDVSHSRVARSDLHAFPK
LGAKVRLCGPPTMMPAGVERLGATVHTDLREAVDGADAVIMLRIQHERIGDPLIPGTREY
SKVWGLNAKKAADWLKPSCVILHPGPINRGVELSPEVADGPRSVILDQVQNGVAVRMAIL
YLLAGGAGEEARA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggtcgacacaagcactgcatcgcgctggaggacttctcccgcgaggagatcctc
gaggtcatcgacctcgcggtctccatgaaggaggtgctgcagcggcccatcaagaaggtc
ccgagcctgcgcggcaagatggtggtgaacctgttcttcgaggcctccacccgcacccgc
agctccttcgagaccgccgccaagatcctctccgccgacgcgctcaactggacgtcgtcg
tcctcgtcggtcaccaagggcgagacgctggtggacacggcgaagaacctcgaggcgatg
cgcccggacgtgctggtgatccggcactcggccggcggcgcgccgcggctggtcgcggag
cacgtgggctgctcggtggtctccgccggcgacggcgcgcacgagcacccgagccagggg
ctcctcgactgcttcacgctgcgggagaagctcggcacgctcgagggcaagaccgtcgcc
atcgtgggcgacgtcagccactcgcgcgtggcccgctccgacctgcacgcgttcccgaag
ctgggggcgaaggtccggctgtgcgggccgcccaccatgatgccggccggggtggagcgg
ctcggcgccacggtccacaccgatctgcgcgaggcggtggacggcgcggacgcggtcatc
atgctgcgcatccagcacgagcgcatcggcgacccgctcatccccggcacgcgcgagtac
tcgaaggtctggggcctgaacgcgaagaaggcggcggactggctgaagccctcctgcgtg
atcctgcaccccggccccatcaaccgcggcgtggagctgtcgcccgaggtggcggacggg
ccccgctcggtgatcctggaccaggtgcagaacggggtggcggtccggatggcgatcctg
tacctgctcgcgggcggcgcgggcgaggaggccagggcgtga

DBGET integrated database retrieval system