KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1627Help
Entry
Adeh_1627         CDS       T00326                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00020  Citrate cycle (TCA cycle)
ade00640  Propanoate metabolism
ade00660  C5-Branched dibasic acid metabolism
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01130  Biosynthesis of antibiotics
ade01200  Carbon metabolism
Module
ade_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ade_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Adeh_1627
   00640 Propanoate metabolism
    Adeh_1627
   00660 C5-Branched dibasic acid metabolism
    Adeh_1627
Enzymes [BR:ade01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Adeh_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABC81400
UniProt: Q2IIC1
Position
1866335..1867501
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQAKEILRKFGVAVPRGYLAVTPLEAEGAARQLGGGISAVKAQIHAGGRGKGGGV
KLARSPDEARQHAEAMLGMMLKTPQTGPEGQEVRKVYVEEGCRIARELYLGMTLDREIGR
LAVMASVEGGVDIEEVAAKHPDKILREWISPLTGLMPFQARRLAFGLGLSGDSVTAFVRF
ATGLYNAYVATDASLAEINPLVITVGGEVLALDAKMNFDDNALYRHPDIAAMRDPDEEDP
KETQAKEYDLSYIALDGDIGCMVNGAGLAMATMDVIKLSGGQPANFLDVGGGADEDKVTA
AFKIILSDPHVKAVLVNIFGGIMKCDVIANGIVAAAKQVGLSIPLVVRLEGTNVELGKEI
LAHSELKIIPADDLGEAARKAVQAARAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatccacgagtaccaggcgaaggaaatcctgcggaagttcggcgtggcggtgccg
cgcggctacctcgcggtcacgccgctcgaggcggagggcgcggcgcgccagctcggcggc
ggcatcagcgcggtgaaggcgcagatccacgcgggcggccgcggcaagggcggcggcgtg
aagctggcccgctcgccggacgaggcccgccagcacgccgaggccatgctcggcatgatg
ctgaagaccccgcagaccgggccggaggggcaggaggtccgcaaggtctacgtcgaggag
ggctgccggatcgcccgcgagctgtacctcggcatgacgctggaccgcgagatcgggcgc
ctggcggtgatggcctcggtcgagggcggcgtggacatcgaggaggtggccgcgaagcac
cccgacaagatcctgcgggagtggatctcgccgctgaccggcctcatgccgttccaggcc
cgccggctcgcgttcggcctcggcctctccggcgactcggtcaccgcgttcgtgcgcttc
gccaccggcctgtacaacgcctacgtcgccaccgacgcgtcgctcgccgagatcaacccg
ctcgtcatcacggtgggcggcgaggtgctcgcgctcgacgcgaagatgaacttcgacgac
aacgcgctctaccggcacccggacatcgcggccatgcgcgatccggacgaggaggatccg
aaggagacgcaggccaaggagtacgacctctcgtacatcgcgctggacggcgacatcggc
tgcatggtgaacggcgccggcctggcgatggccaccatggacgtcatcaagctgtccggc
ggccagccggccaacttcctcgacgtgggcggcggcgccgacgaggacaaggtcaccgcg
gccttcaagatcatcctctccgacccgcacgtgaaggcggtgctggtcaacatcttcggc
ggcatcatgaagtgcgacgtgatcgcgaacggcatcgtcgccgccgcgaagcaggtgggg
ctctcgatcccgctggtggtccggctcgagggcaccaacgtcgagctgggcaaggagatc
ctcgcccacagcgagctgaagatcatccccgccgacgatctcggcgaagccgcccggaag
gccgtccaggccgcgcgggccgcctag

DBGET integrated database retrieval system