KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1723Help
Entry
Adeh_1723         CDS       T00326                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00260  Glycine, serine and threonine metabolism
ade00750  Vitamin B6 metabolism
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01230  Biosynthesis of amino acids
Module
ade_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeh_1723
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Adeh_1723
Enzymes [BR:ade01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Adeh_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Cob_adeno_trans
Motif
Other DBs
NCBI-ProteinID: ABC81496
UniProt: Q2IIL2
Position
complement(1974911..1976269)
Genome map
AA seq 452 aa AA seqDB search
MSAPQFSSWFRCADGCDFRAELTEVVYECPRCGGLLEVEHDRAALATRSAAAWKALFDGR
FKLGAWPYGSGVWGKKEWVYPGIADENVVSMFEGGSPLLRIDRYARELGLDDVWLKECGV
THTGSFKDLGMTVLVSAVKEMRARGAAVRAVACASTGDTSAALSAYCAAAGIPSVVLLPR
GKISTAQLVQPISNGALVLELDTDFDGCMQVVKQLSRTKDIYLANSMNSLRIEGQKTASI
EIAQQLGWTSPDWIVIPGGNLGNASAVGKGFLLMKELGLVDRLPRLVVAQAEHANPLWRA
TTGAGVKPTAAVEVEPLAARKTLASAIQIGAPVSARRALRALEALDGVVEQASEQELADA
AARADRAGMFTCPHTGVALAALEKLAARGVVRRGERVVVISTAHGLKFSDFKVGYHDQTL
PGIRAGLPNPAVQLPATLGAVQDAIAGRFGRG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgccccagttctcgtcctggttccgctgcgcggacggctgcgacttccgcgcc
gagctcaccgaggtggtctacgagtgcccgcgctgcggcgggctgctcgaggtcgagcac
gaccgcgccgcgctcgccacgcgcagcgccgccgcgtggaaggcgctgttcgacgggcgc
ttcaagctgggcgcctggccgtacggctccggcgtgtggggcaagaaggagtgggtctac
ccggggatcgccgacgagaacgtggtctcgatgttcgagggcggcagcccgctgctccgg
atcgaccgctacgcccgcgagctgggcctcgacgacgtgtggctgaaggagtgcggcgtc
acgcacaccgggtccttcaaggacctggggatgacggtgctcgtctccgcggtgaaggag
atgcgggcccgcggcgccgcggtccgcgcggtcgcctgcgcctccaccggcgacacgtcg
gccgcgctctccgcctactgcgccgccgccggcatccccagcgtggtgctgctgccgcgc
ggcaagatctccaccgcgcagctcgtccagcccatctccaacggcgcgctggtgctcgag
ctcgacaccgacttcgacggctgcatgcaggtggtgaagcagctcagccgcaccaaggac
atctacctcgcgaactcgatgaactcgctgcgcatcgaggggcagaagaccgcctccatc
gagatcgcgcagcagctcggctggacctcgcccgactggatcgtgatcccgggcggcaac
ctcggcaacgcgagcgcggtggggaagggcttcctgctcatgaaggagctggggctggtg
gaccggctcccgcgcctggtggtcgcccaggcggagcacgcgaacccgctctggcgcgcc
accaccggcgccggggtgaagcccaccgcggcggtggaggtcgagccgctcgccgcgcgg
aagacgctcgcgtccgccatccagatcggcgccccggtgtcggcgcgccgcgccctgcgc
gcgctggaggcgctcgacggcgtggtcgagcaggcgagcgagcaggaactcgccgacgcg
gccgcgcgcgccgaccgggccggcatgttcacctgcccgcacaccggcgtggcgctcgcg
gcgctcgagaagctcgccgcccgcggggtggtgaggaggggcgagcgggtggtggtgatc
tccaccgcgcacggcctcaagttctccgacttcaaggtcggctaccacgaccagaccttg
cccggcatccgcgccgggctgcccaacccggccgtccagctccccgccacgctcggcgcg
gtccaggacgcgattgccggccgcttcgggcgagggtag

DBGET integrated database retrieval system