KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1825Help
Entry
Adeh_1825         CDS       T00326                                 

Definition
pyruvate dehydrogenase-like complex E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeh_1825
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_1825
   00020 Citrate cycle (TCA cycle)
    Adeh_1825
   00620 Pyruvate metabolism
    Adeh_1825
Enzymes [BR:ade01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Adeh_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2086184..2087512)
Genome map
AA seq 442 aa AA seqDB search
MAYKLELPDIGEGVVEAEVQQWFVAPGDAITEDQPLVEVMTDKATVVIPSPKRGTVVKLF
WKVGDVAKVHSPLVEIELDDAPPRPAPEAPVRAATAAATAQAAAAASVAVGRPAQAEPPA
AAAAPAAAAGPAGAKALATPAVRAMARELGIDVNTVPGTGPGGRVTKDDLSRARGKVNGH
GGETQVPAAPAPAAARAPVPAPAPSAAPEADERIPLRGMRRKIAENMARSKRTAAHFTFV
EQADVTELVRVKERIAAAAKEEGVKVTFLPFVVKAVVAALRKFPKLNASLDDERGEIVLK
RRYDVGVASATDAGLVVPVLRAADRRSLLDLAREIERLSQDTKAGRIRPEDLGNSTFTIT
SLGALGGLFATPVLNHPEVGILGIHRIRPTPVVRDGQIVARDVMHVSLTSDHRVVDGHEA
AAFTYQVIKYLEDPNLLFMQMV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcctacaagctcgagctccccgacatcggcgagggggtcgtcgaggcggaggtccag
cagtggttcgtcgcccccggcgacgcgatcaccgaggaccagccgctcgtcgaggtgatg
accgacaaggcgacggtggtgatcccgtcgccgaagcgcggcacggtggtgaagctgttc
tggaaggtgggcgacgtcgccaaggtgcactcgccgctcgtcgagatcgaactcgacgac
gcgccgccgcgcccggcgcccgaggccccggtgcgcgccgccaccgcggcggcgacggcc
caggcggccgcggcggcgagcgtcgccgtgggccggccggcccaggccgagccgcccgcg
gcggcggcggcccccgcggcggcggccgggcccgcgggcgcgaaggcgctcgccaccccc
gccgtgcgcgccatggcgagggagctcggcatcgacgtgaacacggtgccgggcaccggc
cccggcggccgcgtcaccaaggacgacctgtcgcgcgcgcgcggcaaggtgaacgggcac
ggcggcgagacgcaggtgcccgcggcgcccgcgcccgccgcggcgcgcgcgccggtcccc
gcgccggcgccgtccgctgccccggaggcggacgagcggatccccctccgcggcatgcgg
cggaagatcgccgagaacatggcgcggtcgaagcggaccgccgcccacttcacgttcgtg
gagcaggcggacgtcaccgagctggtccgggtgaaggagcggatcgccgccgccgcgaag
gaggagggcgtcaaggtcacgttcctgccgttcgtggtgaaggcggtggtggccgcgctg
cgcaagttcccgaagctgaacgcgtcgctcgacgacgagcgcggcgagatcgtgctgaag
cgccggtacgacgtcggcgtcgcctcggccaccgacgcggggctggtggtcccggtgctc
cgcgccgccgaccgccgctcgctcctcgacctcgcccgcgagatcgagcggctctcccag
gacaccaaggccggccgcatccgccccgaggacctgggcaactccacgttcaccatcacc
agcctgggcgcgctgggcgggctgttcgccaccccggtgctgaaccaccccgaggtcggc
atcctgggcatccaccgcatccggcccacgccggtggtgcgcgacgggcagatcgtcgcg
cgcgacgtgatgcacgtctcgctgacgagcgatcaccgcgtggtggacgggcacgaggcg
gccgcgttcacctaccaggtgatcaagtacctcgaggatccgaacctcctgttcatgcag
atggtgtga

DBGET integrated database retrieval system