KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1947Help
Entry
Adeh_1947         CDS       T00326                                 

Gene name
tuf
Definition
elongation factor Tu (EC:3.6.5.3)
Orthology
K02358  
elongation factor Tu
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Brite
Mitochondrial biogenesis [BR:ade03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Adeh_1947 (tuf)
Exosome [BR:ade04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Adeh_1947 (tuf)
  Exosomal proteins of breast cancer cells
   Adeh_1947 (tuf)
  Exosomal proteins of colorectal cancer cells
   Adeh_1947 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2186228..2187418)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAITKVLAQKGGAQFLAYDQIDKAPEERERG
ITIATAHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKVDMVDDKELLDLVELEVRELLSEYDFPGNEIPIVKGSALKALE
GDKGELGEQAIFKLMEAVDAYIPTPQRATDKPFLMPVEDVFSISGRGTVATGRVERGIVK
VGEEVEVVGLKATAKTVVTGVEMFRKLLDEGRAGDNIGALLRGLKREEVERGQVLAKPGS
ITPHTKFKAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGSVQLPQGVEMVMPGDNIG
MEVELITPIAMEKELRFAIREGGRTVGAGVVAEVIQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggagaagttcgagcgcagcaagccgcacgtgaacgtcgggacgatcgggcac
gtggaccacggcaagacgacgctgacggcggcgatcacgaaggtgctggcgcagaagggc
ggggcgcagttcctggcgtacgaccagatcgacaaggcgccggaggagcgcgagcgcggg
atcacgatcgcgacggcgcacgtggagtaccagacggagaagcggcactacgcgcacgtc
gattgcccgggccacgcggactacgtgaagaacatgatcaccggggcggcgcagatggac
ggcgcgatcctggtggtgtcggcggcggacggtccgatgccgcagacgcgcgagcacatc
ctgctggcccgccaggtgggcgtgccgtacatcgtggtcttcctgaacaaggtggacatg
gtggacgacaaggagctcctggatctggtggagctggaggtccgggagctgctgagcgag
tacgacttcccgggcaacgagatcccgatcgtgaaggggtcggcgctgaaggcgctggag
ggcgacaagggcgagctcggggagcaggcgatcttcaagctgatggaggcggtggacgcc
tacatcccgacgccgcagcgcgcgacggacaagccgttcctgatgccggtcgaggacgtg
ttctcgatctcgggccgcgggacggtggcgacggggcgcgtggagcgcgggatcgtgaag
gtcggcgaggaggtcgaggtcgtcgggctgaaggcgacggcgaagacggtggtgaccggc
gtcgagatgttccgcaagctgctggacgaggggcgtgcgggcgacaacatcggggcgctg
ctgcgcggcctgaagcgcgaggaggtggagcgcggtcaggtgctggcgaagccggggtcg
atcacgccgcacacgaagttcaaggccgaggtgtacgtgctgacgaaggaggagggtggt
cgtcacaccccgttcttcaacggctaccggccgcagttctacttccggacgacggacgtg
acggggtcggtgcagctgccgcagggagtcgagatggtgatgccgggcgacaacatcggg
atggaggtggagctgatcacccccatcgcgatggagaaggagctccggttcgccatccgc
gagggcggccgcacggtcggcgcgggcgtggtggccgaggtcatccagtag

DBGET integrated database retrieval system