KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2140Help
Entry
Adeh_2140         CDS       T00326                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Adeh_2140
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Adeh_2140
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Adeh_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2417350..2418135
Genome map
AA seq 261 aa AA seqDB search
MSAGLDGRAALVTGAASGIGREIAEQLAREGARVVLADLDAAGAGQAAAALAAQGLVAQG
IGCDVTREADVERAVAAVLAAHGRLDVLVNNAGLQHVAPLDAFPTERFELLLRVMLVGPF
LATKHAFPVMRRQRHGRVVNVASVNGLVGFAGKAAYNSAKHGLLGLTKVAALEGAADGIT
VNALCPGYVDTPLVRNQLADLARTRGVPLERVLEDVIYPLVPQRRLLSPREVADYALFLA
SDRAAGVTGSAAVVDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgggctggacgggcgggccgcgctggtcaccggcgcggcgagcggcatcggc
cgcgagatcgcggagcagctcgcgcgggagggcgcccgggtggtgctggccgacctcgac
gccgcgggcgccgggcaggccgccgccgcgctggcggcccaggggctcgtggcgcagggc
atcggctgcgacgtcacccgcgaggcggacgtggagcgggcggtcgccgcggtgctcgcc
gcgcacgggcggctcgacgtgctcgtgaacaacgccgggctgcagcacgtggcgccgctc
gacgcgttccccaccgagaggttcgagctgctgctgcgggtgatgctggtcgggccgttc
ctcgccaccaagcacgcgttcccggtcatgcgccggcagcggcacgggcgcgtcgtgaac
gtggcgtcggtgaacggcctcgtcggcttcgccggcaaggcggcctacaacagcgcgaag
cacgggctgctcgggctcaccaaggtggccgccctggagggcgccgccgacggcatcacc
gtgaacgcgctctgcccgggctacgtggacacgccgctcgtgcgcaaccagctcgccgac
ctggcccgcacccgcggcgtgccgctggagcgcgtgctggaggacgtcatctacccgctc
gtcccgcagcggcggctgctctcgccgcgcgaggtggccgactacgcgctgttcctggcg
agcgatcgcgccgccggggtcaccgggtcggcggcggtggtggacggcggctacaccgcg
cagtag

DBGET integrated database retrieval system