KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2221Help
Entry
Adeh_2221         CDS       T00326                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeh_2221
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Adeh_2221
Enzymes [BR:ade01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Adeh_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2505357..2507606
Genome map
AA seq 749 aa AA seqDB search
MDFEQEVAALRRWFESPRFAGIRRIHTAREVMEQRGTIRQDYPVAREAAEAFHARLRELF
QQRRCITTFGPYSPGQAVAMKKMGIEAIYLGGWATSAKGSVQEDPGPDLASYPLSQVPDE
AAPIVRALLTADRNQHHARSRMTEEQRRATPAVDFRPFIIADADTGHGGDAQVRNLVRRF
VEVGVPGYHIEDQKPGVKKCGHQGGKVLVAEDEQLKRLSAARFQLDLMGVPGIVVARTDA
ESATLLDGRGDERDQPFILGASNLAVPAFRAAFLAILRRFRRAGVEELSGHELYAVCDEE
YAAADAWLDRAGFDKAIAAAAAEHQRGALAVDAALDRVFDRFVDAWQQEAGVCTYAEAVG
QAIAFREHEGERPAMRRDEWMAFAARAPFYRAREKARAMGIDPPWDCEHAKTPDGYYQVR
GGIDYAIQKSLAAAPFADLLWMETKTADLADARRFADAIHAVHPDKMLAYNLSPSFNWDT
TGMDDDQMRRFPEELGKLGFVFDFITYGGHQIDGLAAEEFATALREDGMLALARLQRKFR
LLESGYRTPQTLVGGPRLDAALMAVSGRTATTKAMGQGSTQHQHLVQTEVPPRLLDDWLD
LWRDQHGVPGRLHATLRPVTAGSDLLELVVTSADGERKLDVTFASITDRRGRSILSVRDQ
NTHDLSLRRKRLMTLAQLFLFHRYRVDSAHYVTPTEDNQRQAEGMKALGLFRSVAQEVGE
IIVADVDRARVKALAARDHAALKALIARA
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgagcaggaggtcgcggcgctccgccgctggttcgagagcccacggttcgcg
ggcatccggcgcatccacaccgcccgcgaggtgatggagcagcgcggcacgatccgccag
gactacccggtggcgcgcgaggccgccgaggcgttccacgcgcggctgcgcgagctgttc
cagcagcggcgctgcatcaccaccttcggcccctactcgcccggtcaggccgtggcgatg
aagaagatgggcatcgaggcgatctacctgggcggctgggccacctcggcgaagggctcc
gtccaggaggaccccggccccgacctcgccagctacccgctcagccaggtgcccgacgag
gcggcgcccatcgtgcgcgcgctgctcaccgccgaccggaaccagcaccacgcccgctcg
cgcatgaccgaggagcagcggcgcgccaccccggcggtggacttccggccgttcatcatc
gccgacgccgacaccggccacggcggcgacgcgcaggtgcggaacctcgtgcgccgcttc
gtcgaggtcggggtgcccggctaccacatcgaggaccagaagccgggcgtgaagaagtgc
gggcaccaggggggcaaggtgctcgtcgccgaggacgagcagctgaagcggctctccgcg
gcgcggttccagctcgacctcatgggcgtgcccggcatcgtggtggcgcgcaccgacgcc
gagtcggccacgctgctcgacggccgcggcgacgagcgcgaccagccgttcatcctgggc
gcgagcaacctcgcggtcccggcgttccgcgcggcgttcctggccatcctgcggcggttc
cgccgcgccggcgtggaggagctgtccggccacgagctgtacgcggtgtgcgacgaggag
tacgcggccgccgacgcgtggctggaccgggccggcttcgacaaggccatcgccgccgcc
gccgccgagcaccagcgcggcgcgctcgcggtggacgccgcgctggaccgggtcttcgat
cgcttcgtggacgcgtggcagcaggaggccggcgtctgcacctacgccgaggcggtgggg
caggcgatcgcgttccgcgagcacgagggcgagcgcccggccatgcgccgcgacgagtgg
atggcgttcgccgcgcgcgcgccgttctaccgggcgcgcgagaaggcgcgcgccatgggg
atcgacccgccctgggactgcgagcacgccaagacgcccgacggctactaccaggtgcgc
ggcgggatcgactacgccatccagaagtcgctggcggcggcgccgttcgcggacctgctc
tggatggagacgaagaccgccgacctcgccgacgcgcggcgcttcgccgacgccatccac
gccgtccacccggacaagatgctcgcctacaacctgtcgccgtccttcaactgggacacg
accggcatggacgacgaccagatgcgccgcttccccgaggagctcgggaagctcgggttc
gtcttcgacttcatcacctacggcggccaccagatcgacgggctcgccgcggaggagttc
gcgaccgcgctgcgcgaggacgggatgctcgcgctggcgcggctgcagcggaagttccgg
ctgctcgagtccggctaccggacgccgcagacgctggtgggcgggccgcggctcgacgcg
gcgctcatggccgtctccggccggaccgccaccaccaaggccatgggccagggctcgacc
cagcaccagcacctcgtccagaccgaggtgccgccccggctgctggacgactggctcgac
ctgtggcgcgaccagcacggcgtgccgggcaggctccacgccacgctcaggccggtcacc
gccggctccgacctgctcgagctggtggtcacgtccgccgacggcgagcggaagctcgac
gtcaccttcgcgagcatcaccgaccgccgcgggcgcagcatcctctcggtgcgcgaccag
aacacgcacgacctgtcgctccggcgcaagcggctcatgacgctcgcgcagctgttcctg
ttccaccgctaccgggtggactcggcgcactacgtcacgcccaccgaggacaaccagcgg
caggcggagggcatgaaggcgctcggcctgttccgctcggtggcgcaggaggtgggcgag
atcatcgtcgcggacgtggaccgggcccgggtgaaggcgctcgccgcgcgcgaccacgcc
gcgctgaaggcgctcatcgcccgcgcctga

DBGET integrated database retrieval system