KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2402Help
Entry
Adeh_2402         CDS       T00326                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Adeh_2402
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Adeh_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2709096..2710958)
Genome map
AA seq 620 aa AA seqDB search
MADTKLWTRIAVALAAVGALALAVGCPPSKPKGSKRPAAASDIAVAAEKTYVPPGDLDEY
YMFSSGGHSGQVFVYGIPSMRHITTIPVFSPYSGTGYGYDDETKAMLGKLTWGDVHHPAL
SETGGDYDGRWLFVNEMNGRVARIDLRDFKTRQILGPVPNISGNHGSTFITPNSEYILMS
SRFSIPIPKGRAVSIDRYASEYKGVAAGIKVDPKTGEMSLGWQVLLPPFDWDLGDAGKKL
SEGWFFLTCYNSERATGKLEVTASQRDRDYIAAIDWRLAEKAAAEGKGELIGGVKVLDPK
NVPGLVYLMPCGKSPHGVDVSPDGKYVVGSGKLQGVTTAFNFEKVLTAIKNKDFAGEEDG
IPVLKYESIKDAEVPVGLGPLHTQFGPDGMAYTSLFVDSALAKWKLGTWEVLDKVPMSYS
TGHLAAAEGDTVSPDGKWLVGLNKLSHGRHLSVGPSQPESSQLVDISGDKMKLVYDAFTE
PEPHYAQIIKADKLKPIEVYPKEENKHPLAIWDVKDAGVTRKGTEVLAKVVVVRSSMTPA
LIEVNEGDTVKVALTNIEQTTDELHGFGLLDYNINIVLDPGETKTVTFKADKPGVFPYYC
TNFCSALHQEMQGYLVVKPK
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgaagctctggacgaggatcgccgtggcgctcgcggcggtgggggcgctg
gcgctggccgtgggctgcccgcccagcaagccgaagggctcgaagcgcccggccgcggcg
tcggacatcgcggtggcggccgagaagacctacgtgccgccgggagatctcgacgagtac
tacatgttctcgtccggcgggcactccgggcaggtcttcgtctacggcatcccgtcgatg
cgccacatcaccaccatcccggtgttctccccgtactcgggcacgggctacggctacgac
gacgagacgaaggccatgctcggcaagctcacctggggtgacgtgcaccacccggcgctc
tccgagaccggcggcgactacgacgggcgctggctgttcgtgaacgagatgaacgggcgg
gtggcgcgcatcgacctgcgcgacttcaagacccggcagatcctcgggccggtgccgaac
atctccggcaaccacgggtccaccttcatcaccccgaacagcgagtacatcctcatgtcc
tcgcggttctccatccccatcccgaaggggcgggcggtgtccatcgaccgctacgccagc
gagtacaagggcgtcgcggccggcatcaaggtcgatccgaagaccggcgagatgtccctg
ggctggcaggtgctgctgccgcccttcgactgggacctcggcgacgcgggcaagaagctg
tccgagggctggttcttcctcacctgctacaactcggagcgcgccaccggcaagctcgag
gtcaccgcctcgcagcgcgaccgcgactacatcgcggccatcgactggcgcctcgcggag
aaggccgcggcggaggggaagggcgagctcatcggcggcgtgaaggtgctcgacccgaag
aacgtccccggcctcgtgtacctgatgccctgcgggaagtcgccgcacggcgtggacgtc
tcgcccgacggcaagtacgtggtcggctcgggcaagctccagggcgtcaccaccgccttc
aacttcgagaaggtcctcaccgccatcaagaacaaggacttcgccggcgaggaggacggc
atcccggtcctgaagtacgagtcgatcaaggacgcggaggtgccggtcggcctcgggccg
ctccacacgcagttcgggccggacgggatggcgtacacctcgctgttcgtggacagcgcg
ctggcgaagtggaagctcgggacgtgggaggtgctggacaaggtcccgatgtcctactcg
accggccacctcgccgcggccgagggcgacacggtgtcgccggacgggaagtggctggtg
ggcctcaacaagctgtcgcacggccggcacctctcggtcggcccgtcgcagcccgagtcc
tcgcagctcgtggacatctcgggcgacaagatgaagctggtctacgacgcgttcaccgag
cccgagccgcactacgcgcagatcatcaaggcggacaagctgaagccgatcgaggtctac
cccaaggaggagaacaagcacccgctggcgatctgggacgtgaaggacgccggggtgacg
cgcaaggggaccgaggtgctggcgaaggtggtggtggtgcgctccagcatgacgccggcg
ctcatcgaggtgaacgagggcgacacggtgaaggtggcgctcaccaacatcgagcagacc
accgacgagctccacggcttcggcctgctcgactacaacatcaacatcgtcctcgatccc
ggcgagaccaagaccgtcacgttcaaggccgacaagccgggcgtgttcccctactactgc
acgaacttctgctccgcgctccaccaggagatgcagggctacctcgtggtgaagccgaag
tga

DBGET integrated database retrieval system