KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2491Help
Entry
Adeh_2491         CDS       T00326                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Adeh_2491
Enzymes [BR:ade01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Adeh_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2811943..2812737)
Genome map
AA seq 264 aa AA seqDB search
MPAAPARPLAGRTVVVTRGKGSEGKDALAVRLEELGAEVRALPSIAFAPPADPAPLDAAL
RGLERFDWAVFTSANAVDRTVERLRALGLAPAALGRLRLAAVGPATAERLAALVRAPDVV
PVEAKGDVLARTLGEQVRGRRVLFPRPAEGRPETVAGLLAAGAELTAVEAYRTMPAPPEA
LGCLAGWLAAGEVAAVAFASPSAVAAVVGALGDRSALLRGVLIAAIGPTTADALREAGLP
VGAVPAHYTGRDLAEAIAARLGPG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccgcgcccgcgcggccgctggccggccgcaccgtggtggtgacccggggcaag
ggctccgagggcaaggacgcgctcgccgtccggctcgaggagctgggcgcggaggtgcgc
gcgctgccgtcgatcgcgttcgcgccgccggccgaccccgccccgctcgacgccgcgctg
cgcgggctcgagcgcttcgactgggcggtgttcacgagcgcgaacgcggtggaccggacg
gtggagcggctgcgcgcgctcggcctcgctccggccgcgctgggccggctccgcctcgcc
gccgtcgggccggccaccgccgagcggctggcggcgctcgtgcgcgcgccggacgtggtg
ccggtcgaggcgaagggcgacgtgctcgcgcgcacgctcggcgagcaggtgcgcggccgg
cgggtgctgttcccgcgcccggccgaggggcggccggagacggtcgcggggctgctggcc
gccggcgccgagctgaccgcggtcgaggcgtaccggacgatgccggcgccgcccgaggcg
ctcgggtgcctggcgggctggctcgcggcgggcgaggtggcggcggtggcgttcgcgtcg
ccctcggcggtggcggcggtggtcggggcgctcggcgaccggtcggccctcctccgaggg
gtgctgatcgcggcgatcggccccacgacggcggacgccctgcgcgaggccgggctcccc
gtgggcgccgtcccggcgcactacaccggccgagacctcgcggaggccatcgccgcgcgg
ctcgggcccgggtag

DBGET integrated database retrieval system