KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2522Help
Entry
Adeh_2522         CDS       T00326                                 

Definition
purine-nucleoside phosphorylase (EC:2.4.2.1)
Orthology
K03784  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ade00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ade00240]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ade00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2844435..2845034)
Genome map
AA seq 199 aa AA seqDB search
MAERPSLLLAAFPPELAGLDAAPPPGWIAGVTGVGAVSAAIETARLVAQHAPARVLFVGT
CGAYDARLAPGDLLSASEAVATSLDEVEGRAYRPAIERVRWPAGWALPLPAHAVAVPPAI
TRTAAGARALAAVGAAEHLELTGVFAACHAAGVPAAAALAVANRVGPDAHAEWKAAHAAA
SAALRAALEARGVLPAHGP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacgcccgagcctgctcctcgccgccttcccgcccgagctggcgggcctcgac
gcggcgccaccgcccggctggatcgcgggcgtcaccggggtgggcgccgtctccgccgcg
atcgagacggcgcgcctcgtcgcccagcacgcgccggcgcgcgtcctgttcgtcgggacc
tgcggcgcctacgacgcgcggctcgcgcccggcgacctgctctccgcgtccgaggccgtc
gcgacctcgctcgacgaggtggagggccgggcgtaccggcccgcgatcgagcgggtgcgc
tggccggcgggctgggcgctgccgctcccggcgcacgcggtggcggtgccgcccgccatc
acccgcaccgcggcgggcgcccgcgcgctcgccgccgtgggggcggcggagcacctcgag
ctgaccggcgtcttcgccgcctgccacgcggcgggcgtgccggcggccgcggccctggcg
gtggcgaaccgggtcgggccggacgcgcacgcggagtggaaggcggcgcacgccgccgcg
agcgcggcgctccgggcggcgctggaggcgcgcggcgtgctcccggcgcacggtccctga

DBGET integrated database retrieval system