KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2522Help
Entry
Adeh_2522         CDS       T00326                                 

Definition
purine-nucleoside phosphorylase (EC:2.4.2.1)
Orthology
K03784  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Adeh_2522
   00240 Pyrimidine metabolism
    Adeh_2522
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Adeh_2522
Enzymes [BR:ade01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     Adeh_2522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2844435..2845034)
Genome map
AA seq 199 aa AA seqDB search
MAERPSLLLAAFPPELAGLDAAPPPGWIAGVTGVGAVSAAIETARLVAQHAPARVLFVGT
CGAYDARLAPGDLLSASEAVATSLDEVEGRAYRPAIERVRWPAGWALPLPAHAVAVPPAI
TRTAAGARALAAVGAAEHLELTGVFAACHAAGVPAAAALAVANRVGPDAHAEWKAAHAAA
SAALRAALEARGVLPAHGP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacgcccgagcctgctcctcgccgccttcccgcccgagctggcgggcctcgac
gcggcgccaccgcccggctggatcgcgggcgtcaccggggtgggcgccgtctccgccgcg
atcgagacggcgcgcctcgtcgcccagcacgcgccggcgcgcgtcctgttcgtcgggacc
tgcggcgcctacgacgcgcggctcgcgcccggcgacctgctctccgcgtccgaggccgtc
gcgacctcgctcgacgaggtggagggccgggcgtaccggcccgcgatcgagcgggtgcgc
tggccggcgggctgggcgctgccgctcccggcgcacgcggtggcggtgccgcccgccatc
acccgcaccgcggcgggcgcccgcgcgctcgccgccgtgggggcggcggagcacctcgag
ctgaccggcgtcttcgccgcctgccacgcggcgggcgtgccggcggccgcggccctggcg
gtggcgaaccgggtcgggccggacgcgcacgcggagtggaaggcggcgcacgccgccgcg
agcgcggcgctccgggcggcgctggaggcgcgcggcgtgctcccggcgcacggtccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system