KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3001Help
Entry
Adeh_3001         CDS       T00326                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Adeh_3001
Enzymes [BR:ade01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Adeh_3001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3402809..3404365
Genome map
AA seq 518 aa AA seqDB search
MRDRRSGLLLHPTSLPGPHGAGDLGAAAHRFAGWLADAGQRLWQVLPLGPTGFGDSPYQA
LSSHAGNPLLVSLEVLRNEGWLDDADLSGAPAGEPGRADLHAALEWKRERLARAARAFRA
GADGERAAELEDFRAREAGWLEDWALFAALKAAHGGRPWTAWPAPLARRERAALESARAR
FAHEVFAEVFAQFAFHRQWAALRARCRALGIELMGDLPIYVAHDSAEVWARPELFRLDAA
GEPAAVAGVPPDYFSATGQRWGNPLYDWEAVAREGWRFWIERVRGTLALVDRIRLDHFRG
FEAYWEIPAGAPTAERGRWVPGPGARLFEALLRALGPLPFVAENLGVITPEVEALRRRFG
LPGMAILQFAFGDDPQAPTFQPHNYAPDLVAYTGTHDNDTVAGWWGGGAGDSVRTAEAVA
REKAFALEYLGVDGRDVPGAMIRAVLASVADTAVFPLQDALGLGSEARMNTPATLGGNWR
WRVREEALDAALAARLRRLAAVYGRAPAQAGLRSSNQK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatcgccgctccggcctcctgctccacccgacctcgctgcccggcccccacggc
gcgggcgacctcggcgccgcggcccaccgcttcgccgggtggctcgccgacgccggccag
cgcctctggcaggtgctgccgctgggcccgaccggcttcggcgactccccctaccaggcg
ctctcctcgcacgccgggaacccgctgctggtgtcgctggaggtcctccgcaacgagggc
tggctggacgacgccgacctctcgggcgcgccggccggcgagccgggccgggccgacctg
cacgccgcgctggagtggaagcgcgagcggctggcgcgcgcggcgcgggcgttccgggcg
ggggcggacggggagcgcgccgcggagctggaggacttccgcgcccgcgaggcgggctgg
ctggaggactgggcgctgttcgcggccctgaaggcggcgcacggggggcggccctggacg
gcgtggccggcgccgctcgcccggcgcgagcgggccgcgctggagtcggcgcgggcgcgc
ttcgcgcacgaggtgttcgccgaggtgttcgcgcagttcgcgttccaccggcagtgggcg
gcgctgcgcgcgcgctgccgcgcgctcgggatcgagctgatgggcgacctgcccatctac
gtggcccacgactcggccgaggtgtgggcccggccggagctgttccggctcgacgcggcc
ggcgagcccgccgcggtggccggcgtcccgcccgactacttcagcgccaccggccagcgc
tgggggaacccgctctacgactgggaggcggtggcgcgcgagggctggcgcttctggatc
gagcgcgtgcgcggcacgctcgcgctggtggaccggatccggctcgaccacttccgcggc
ttcgaggcgtactgggagatccccgccggcgcgcccaccgccgagcgcggccgctgggtg
cccggccccggcgcgcgcctgttcgaggcgctcctccgcgcgctcggtccgctgccgttc
gtggccgagaacctgggcgtcatcacgccggaggtggaggcgctccggcggcgcttcggc
ctcccggggatggccatcctgcagttcgcgttcggggacgacccgcaggcgccgaccttc
cagccgcacaactacgcgccggacctcgtcgcctacaccgggacgcacgacaacgacacg
gtggcgggctggtgggggggcggcgcgggcgacagcgtgcggacggccgaggcggtggcg
cgggagaaggcgttcgcgctcgagtacctgggggtggacggccgcgacgtgccgggcgcg
atgatccgcgcggtgctcgcctcggtggcggacacggccgtgttcccgctccaggacgcg
ctggggctcggctcggaggcgcgcatgaacacgcccgccaccctgggcggcaactggcgc
tggcgcgtgcgcgaggaggcgctcgacgcggcgctggcggcgcggctgcggcggctcgct
gcggtgtacgggcgcgcccccgctcaggcgggcttgcgcagctcgaaccagaagtag

DBGET integrated database retrieval system