KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3073Help
Entry
Adeh_3073         CDS       T00326                                 

Definition
hypothetical protein
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3493039..3494460)
Genome map
AA seq 473 aa AA seqDB search
MVRHRGAALALLLAIGGSGCSAVRGRSANPGPLGADGDLYVFLQPLAREVENVTFGVTAV
EAVGPGEAAAQPMRAALSEVGRHGNGRQRLLAHARLPAGNYAGLRLHVGRARMETPDGPA
DLLVRSEAVQVPASFTVTPGRAQVLWLVLREAQPAGDEVAFAPRFSLLAPETTHPQRLGY
CASTADNVLLAFDRYDRQVTAAIATGMGPAGVAMDEGANLAYVALSLEDRIEVLDLTNGQ
VREPIRLRPGDGPFDVTLVEGGRTLLVVNRRSSTVSFLDTSARVEVGRVAVGEEPWSLRL
DAQRHRAYVFGRRSNTVTAVDVTRRAAVGSAAAEPEPLRGDLDRNGSRLFVVHAGSAYLS
IYTLPELAPAGRLFVGLGATAILVDPRTDLLYVAQAGSPALAVFDPFSLVPLGGVDVGGA
ASFLVFDATQSLLFALLPDRRAVSVVDLTAQRQVGLFEVGREPYDLALSGERR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggtccgacatcgaggcgccgcgctcgcactgctgctggccatcggcggctcggggtgc
tcggcggtgcgcggacgctccgcgaacccggggccgctcggcgccgacggcgacctctac
gtcttcctgcagccgctcgcgcgggaggtcgagaacgtgacgttcggcgtcacggcggtc
gaggccgtcgggccgggggaggccgccgcgcagccgatgcgggcagcgctctccgaggtc
ggccgccacggcaacggccggcagcggctcctcgcgcacgcccggctccccgcgggcaac
tatgccgggctccgcctccacgtcgggcgcgctcgcatggagacgccggacggacccgcc
gatctgctggtacgctccgaggcggtgcaggtgcccgcgtccttcacggtcacgcccggc
cgcgcccaggtgctgtggctcgtcctccgcgaggcgcagccggccggcgacgaggtcgcc
ttcgcgccgcgcttctcgctgctggcgccggagacgacgcacccgcagcggctcggctac
tgcgcgagcaccgcggacaacgtgctcctcgccttcgaccggtacgaccgccaggtgacc
gccgcgatcgcgacgggcatggggcccgcgggcgtggccatggacgaaggcgccaacctc
gcgtacgtggcgctctccctcgaggaccggatcgaggtgctggacctcacgaacgggcag
gtgcgcgagccgatccggctgcgccccggcgacggtccgttcgacgtcaccctcgtagag
ggcggccggacgctgctggtcgtgaaccggcgctccagcaccgtctccttcctggacacg
agcgcacgcgtcgaggtgggtcgagtggcggtgggcgaggagccctggtcgctgcggctc
gacgcacagcgccaccgcgcctacgtgttcgggcggcgctccaacacggtcaccgccgtg
gacgtcacgcgccgcgccgccgtcggctcggcggcggccgagcccgagccgctccgcggc
gacctcgaccggaacggctcccgcctgttcgtggtccacgccgggtcggcctacctgtcc
atctacacgctccccgagctcgcgccggcgggccgcctgttcgtggggctgggggcgacc
gccatcctcgtcgatccccggaccgacctcctctacgtcgcgcaggcgggcagccccgcg
ctcgcggtgttcgacccgttctcgctggtgccgctcggcggcgtggacgtgggcggcgcg
gcctcgttcctggtcttcgacgcgacgcagagcctgctgttcgcgctcctgccggatcgg
cgggccgtctcggtcgtcgatctcaccgcgcagcgccaggtcggcctgttcgaggtcggg
cgcgaaccctacgatctcgcgctgtccggggagcgccgttga

DBGET integrated database retrieval system