KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3081Help
Entry
Adeh_3081         CDS       T00326                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Adeh_3081
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Adeh_3081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3507399..3509042
Genome map
AA seq 547 aa AA seqDB search
MPGPTEPALPDTRFDFDYLVIGSGFGGAVSALRLAEKGWRVGVLEMGKRWRPEDFPRTNW
NLRKFLWMPRLRLFGIQQITLLRDVLVLHGAGVGGGSLVYANTLLVPPDRAFDDPRWPGG
GWRARLAPHYATAKFMLGAVEAPEVFPGDEALRQAVDEETGRGHTFSRHTVAVHFGDAKR
AVPDPYFGGEGPERIGCSLCGECMTGCRHGAKNTLDRNYLHLAERRGAEILPETLVTDLR
PLAGGGWEVHTRSSTHVVRRQRRVLRARGVVLAAGAIGTVRLLLRCKAVGSLPALSGQVG
NHVRTNSEALLAVTARRDDVDYSHGLAITSGLQADDDTHMEVVRYGAGHDFMSLLATHLT
GGGPPWPRPLRWLGNLFRHPVDFFRAHWPFGWARRTAVLLVMQPLASHLRLRLARRPWGR
SLTSALDGPRPPSYMPLANAVARRMAARMDGVAQSGLHEVFLGASSTAHILGGATMGASP
AEGVCDAQGHVFGYQDLYVADGSLVPANLGVNPSLTITALAEHVMSRIPANPAGGQRPAP
RPPGGAA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcccggccccaccgagcccgccctgcccgatacgcgcttcgacttcgactacctggtg
atcggctccggcttcggcggcgcggtgtcggcgctgcggctcgccgagaagggctggcgc
gtcggcgtgctcgaaatgggcaagcgctggcgcccggaggacttcccgcgcacgaactgg
aacctgcgcaagttcctgtggatgccgcggctgcggctgttcgggatccagcagatcacg
ctcctgcgcgacgtgctcgtgctgcacggcgcgggcgtgggcgggggcagcctggtctac
gcgaacacgctgctcgtcccgccggaccgcgccttcgacgatccgcgctggccgggcggc
ggctggcgggcgcgcctcgcgccgcactacgcgacggcgaagttcatgctgggcgcggtg
gaggcgcctgaggtgttcccgggcgacgaggcgctgcgccaggcggtggacgaggagacc
gggcgcggccacacgttctcgcgccacaccgtggcggtgcacttcggcgacgcgaagcgg
gccgtgccggacccgtacttcggcggcgaggggccggagcggatcggctgctcgctctgc
ggcgagtgcatgacgggctgccgccacggcgcgaagaacacgctcgaccggaactacctc
cacctggccgagcggcgcggggcggagatcctgccggagacgctggtcaccgacctgcgc
ccgctggcgggcggcggctgggaggtccacacgcggtcgtccacgcacgtggtccggcgc
cagcggcgcgtgctccgcgcgagaggcgtggtgctggccgcgggcgcgatcggcacggtg
cgcctgctgctccgctgcaaggcggtcgggagcctcccggcgctctccggccaagtcggc
aaccacgtgcgcacgaacagcgaggcgctgctggcggtgacggcgcgccgcgacgacgtg
gactacagccacggcctcgccatcacctcgggcctgcaggcggacgacgacacgcacatg
gaggtggtccgctacggcgcgggccacgacttcatgtcgctcctcgccacgcacctcacc
ggcggcggcccgccctggccgcgcccgctgcgctggctcgggaacctgttccggcacccg
gtggacttcttccgcgcgcactggccgttcggctgggcgcgccgcaccgcggtgctgctc
gtgatgcagccgctcgcgagccacctgcggctgcggctcgcgcgccggccgtgggggcgc
tcgctcaccagcgcgctcgacggcccgcggccgccgagctacatgccgctcgcgaacgcg
gtggcgcgcaggatggcggcgcgcatggacggggtggcgcagagcgggctccacgaggtg
ttcctgggcgcgtcgagcaccgcgcacatcctgggcggcgcgaccatgggcgcctcgccg
gccgagggcgtgtgcgacgcgcaggggcacgtgttcggctaccaggacctctacgtcgcc
gacggcagcctggtgccggcgaacctgggcgtgaacccgtcgctcaccatcacggcgctg
gccgagcacgtcatgagccggatcccggccaacccggccggcgggcagcggccggccccg
cggccgccgggtggcgccgcgtga

DBGET integrated database retrieval system