KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3183Help
Entry
Adeh_3183         CDS       T00326                                 

Definition
signal transduction histidine kinase (EC:2.7.3.-)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ade00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Adeh_3183
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Adeh_3183
Enzymes [BR:ade01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Adeh_3183
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Adeh_3183
Two-component system [BR:ade02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Adeh_3183
Bacterial motility proteins [BR:ade02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Adeh_3183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3628809..3632648
Genome map
AA seq 1279 aa AA seqDB search
MQTVGSPPVGGRRAAAPPLTAGLAASHPPSTEHRGLTMATPKPEPAASDAQEAEWRAREG
ERLLVVGIGASAGGLEALERFLRRVPPDSGLAYVVVQHLSPEHESSLADILARATQLPVE
LASEGKRIERDHVYVIPPAAGLVVERGALRLVPFDHKGARLLVNTFLTSLAEDQRENAVG
IVLSGTGSDGALGIAAVKRHGGRTFAQAPGDARYESMPAAAIATGMVEQVLPAEEIPAAL
VKLAAERRHHPPESARGEAEGLGQALEAVGRTTGHDFSRYKRTTILRRLHRRMAATGVGT
VREYAALLQGDADETRLLAEDLTINVTSFFRDDAPFRVLEQVVIPDLLKRRRAEGVRLWV
PACSSGEEAYSLAILFCERGDELPRPPQIQVFATDIDASALAEARRGQYTSVVERQVSAE
RLARFFTRRGDSYSVTRPLRDLCIFTEHDLVRDPPFSRMDLVSCRNLLIYLEPALQKRVI
ELLHYALRPGGYLLLGKAEMIDAQELELFEVVDKTERVFRRREVDRRPAILPPGRRALPL
ELAAPSRRGDPEVRSAADRSRSIVLEEYAPPSVVVDARGEIRYYWGTKLAFFLPPRAGAP
STNLMHVARRELRVELSAALHNAARQAKPVTYKDVVVEAEGVQRRLNIVVRPLPPSERDP
DELFLVVFEELQSVPIAHGTPLDAPTLERHQQLQRDLESTQERLQVTIEELENANEALRS
SNEQLQAMNEEMHSANEELQTSQEELQSVNEELNTLNAELNKKVDELELLYGDIQNLFQS
TQIATIFLDRQSRIARFTPAATAVFRLADGDVGRPLSDFAARFDAQGVPQEVARVLETLA
PIERTVGLVDEKRSFLMRMNPYRTPSNVIAGVVVSFIDITQLKETEAALRRAVEERERAE
QSLRDEDRRKDQFLAVLSHELRNPLAPILSSLHVLEHGTADTGAAAKAHAIIARQVGYLA
RLVDDLLDVTRIANGKLQVERRPLDLRELARRTAEDHRVTFTTREVALEVALPHEPVWVE
GDSTRLAQVIGNVLQNAAKFTPGGGSVRLSLEAADPVAVLRVRDTGVGVDPAMIPRLFQP
FSQADTTLDRRLGGLGLGLALVKGLVETHGGTIALSSGGKGMGTEVTVRLPLVAAPAGVA
VAPAAAPPRPRRILVIEDNVDAAESLRLALELEGHEVAVAHDGPQGIRRAHELTPEVVLC
DIGLPEMDGYAVARALRREPGLRNTLLIALTGYALPDDHRRAAEAGFDAHLTKPTTLEGV
QEAIDRAPPPASPGGGAPP
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacagtcggatcgccgccggtgggcgggaggcgtgcagccgcaccacccctcacc
gccgggctggctgcttctcacccgccgagcacggagcaccgaggcttgaccatggccacg
ccgaagcccgagcctgccgcgagcgacgcgcaagaagccgagtggcgcgccagggagggc
gagcgtctcctcgtcgtcggcatcggcgcctcggctggcggcctcgaggcgctcgagcgc
ttcctccggcgggtaccgccggacagcggcctcgcctacgtcgtcgtgcagcacctctcc
ccggagcacgagagcagcctcgccgacatcctggcgcgggccacgcagctgccggtcgag
ctcgcgtcggaggggaagcgcatcgagcgcgatcacgtgtacgtcatcccaccggcggcg
gggctcgtcgtggagcgcggcgccctgcggctcgtccccttcgaccacaagggtgctcgc
ctgctggtgaacaccttcctgacctcgctcgcggaggaccagcgcgagaacgccgtcggc
atcgtgctctcggggacgggctccgacggtgcgctcggcatcgctgccgtgaagcgccac
ggcggccggaccttcgcgcaggcccccggcgacgcccggtacgagagcatgcccgccgcc
gcgatcgcgacggggatggtggagcaggtcctccccgccgaggagatcccggcagcgctc
gtcaagctcgccgccgagcggcggcaccatccgcccgagagcgcgcggggcgaggcggag
ggcctcgggcaggcgctcgaggcggtcggccggacgacgggacacgacttcagccgctac
aagcggaccacgatcctccgccggctccaccggcggatggccgccaccggggtcggcacc
gtccgggagtacgccgccctgctccagggggacgccgacgagacccgcctcctcgccgag
gacctgacgatcaacgtgacgagcttcttccgggacgacgcgccattccgggtgctcgag
caggtcgtgatccccgacctcctgaagcgccgacgggccgagggagtccggctctgggtg
ccggcctgctcctccggcgaggaggcctactcgctcgcgatcctcttctgcgagcgcggc
gacgagctgccgcgcccgccgcagatccaggtcttcgcgacggacatcgacgcctcggcc
ctcgcggaggcgcggcgcggccagtacacgagcgtcgtcgagcggcaggtgagcgccgag
cggctggcccggttcttcacgaggcgcggggactcgtactcggtcacgcggccgctccgc
gacctctgcatcttcacggagcacgatctcgtcagggatccgccgttctcgcggatggac
ctcgtgtcctgccgcaacctgctcatctacctggagcccgcgctccagaagcgggtcatc
gagctcctccactacgcgctccgcccgggcggctacctgctcctcggcaaggccgagatg
atcgacgcgcaggagctggagctgttcgaggtcgtggacaagacggagcgcgtgttccgc
cggcgcgaggtggaccggcgcccggcgatccttccgccggggaggcgggcgctgcccctc
gagctggcggcgcccagccggcggggcgatcccgaggtgaggagcgccgccgatcgctcg
cgcagcatcgtgctcgaggagtacgcgccgccgtcggtggtggtcgatgcccgcggcgag
atccggtactactgggggacgaagctggccttcttcctgcccccccgcgccggcgccccc
tcgacgaacctgatgcacgtcgcccggcgcgagctccgggtcgagctctccgccgccctc
cacaacgccgcgcgccaggcgaagcccgtcacgtacaaggacgtggtggtggaggcggag
ggcgtccagcgccggctgaacatcgtcgtccggccgctccctccctcggagcgggatcca
gacgagctgttcctcgtcgtgttcgaggagctgcagtccgttcccatcgcgcacggcacg
ccgctcgacgcgccgacgctggagcgccaccagcagctccagcgcgacctcgagagcacc
caggagcgcctccaggtcacgatcgaggagctcgagaacgcgaacgaggcgctccgcagc
tccaacgagcagctgcaggcgatgaacgaggagatgcactccgccaacgaggagctccag
acctcccaggaggagctgcagtcggtgaacgaggagctcaacaccctcaacgccgagctg
aacaagaaggtggacgagctcgagctgctctacggcgacatccagaacctgttccagagc
acgcagatcgcgaccatcttcctcgaccgtcaatcccggatcgcgcggttcacgccggcc
gcgacggcggtcttccggctcgccgacggcgacgtggggcggccgctgtccgacttcgcg
gcccggttcgacgcccagggcgtgccccaggaggtggcgagggtgctcgagaccctcgcg
cccatcgagcgcaccgtcgggctggtggacgagaagcggtcgttcctcatgcggatgaac
ccgtaccgcaccccatccaacgtgatcgcgggggtggtggtctccttcatcgacatcacc
cagctgaaggagacggaggcggccctgcggcgggcggtggaggagcgcgagcgcgcggag
cagtcgctccgagacgaggaccggaggaaggaccagttcctcgccgtcctgtcgcacgag
ctccggaacccgctcgcgcccatcctgagcagcctccacgtcctcgagcatgggacggcg
gacaccggcgcggcggccaaggcgcacgcgatcatcgcccgccaggtggggtacctcgcc
cggctcgtggacgacctcctcgacgtgacgcggatcgcgaacggcaagctccaggtcgag
cgccggccgctggacctccgcgagctcgcgcggcgtacggccgaggaccaccgggtcacc
ttcaccacacgtgaggtggcgctcgaggtcgcgctcccgcacgagccggtgtgggtcgag
ggggactcgacccgcctcgcgcaggtgatcggaaacgtgctccagaacgcggcgaagttc
acgcccggcggcggctcggtccggctgtccctcgaggccgccgatcccgtcgcggtgctg
cgcgtccgggacaccggcgtcggggtcgatcccgcgatgatcccgcgcctgttccagccg
ttctcgcaggccgacacgaccctcgatcgccgcctcggcgggctcgggctcggcctcgcg
ctcgtgaaggggctcgtcgagacgcacggcggcacgatcgcgctgtcgagcggcggcaag
gggatgggcaccgaggtgaccgtgcggctcccgctcgtggcagcgccggcaggggtcgcg
gtcgcaccggcggcggcgccgccgcgaccgcgccgcatcctggtgatcgaggacaacgtc
gatgccgcggagagcctgcggctcgcgctcgagctggagggccacgaggtggccgtcgcg
cacgacggtccgcaagggatccgtcgagcgcacgagctcacgccggaggtcgtgctctgc
gacatcgggctcccggagatggacggctacgcggtcgcgagggcgctccgccgcgagccc
ggcctcaggaacacgctcctgatcgcgctcaccggctacgcgctcccggatgaccatcgg
cgcgccgccgaggccgggttcgacgcgcacctgaccaagcccacgaccctcgagggggtg
caggaggccatcgatcgtgcgccaccgccggcgtcaccgggcggcggcgcgccgccgtga

DBGET integrated database retrieval system