KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3396Help
Entry
Adeh_3396         CDS       T00326                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00010  Glycolysis / Gluconeogenesis
ade00620  Pyruvate metabolism
ade00640  Propanoate metabolism
ade00680  Methane metabolism
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01120  Microbial metabolism in diverse environments
ade01130  Biosynthesis of antibiotics
ade01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeh_3396
   00620 Pyruvate metabolism
    Adeh_3396
   00640 Propanoate metabolism
    Adeh_3396
  Energy metabolism
   00680 Methane metabolism
    Adeh_3396
Enzymes [BR:ade01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Adeh_3396
Lipid biosynthesis proteins [BR:ade01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Adeh_3396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABC83163
UniProt: Q2IF08
Position
3907848..3909743
Genome map
AA seq 631 aa AA seqDB search
MSSKPQLEGEVFFPSAEVVSQARVPDWAALAKRADEDLEGFWAAEAEELEWYRKWDKVLD
ASEKPFYRWFKGAQTNIVHNCLDRHQRTWRKNKLSLVWVGEKGEVRTYSYFALNRDVSKF
ANVLKAMGVKKGDRVTIYMPRIPEIVIAMLAAAKIGAIHSVVYGGFSVDALQGRIEDSES
KVVITADGGFMNGKIVELKKTVDDAVRRCPTVETVIVVQRTAHEVRMEAGRDYWYHELMK
LPLAAGVCPTEVMDATDPLYILYTSGTTGKPKGLIHGHGGYQVGIYSTLKYVFDIKDEDR
YWCAADPGWVTGHSYIVYGPLLMGATTFMYEGAPTYPYPNRWWSLVEKYGITILYTAPTA
IRGLMRFGESWPNRHDLSTLRLLGSVGEPINPEAWKWYHRVIGKGRCPVMDTWWQTETGM
FMITPVPTLPLKPGSAAKPFFGQQVSILDETGKPVPDGEEGFLVLERPWPAMAMTVYKDP
ERFVKTYWEKYPGRYMAGDAAKRDADGYYWVIGRTDDVIKVSGYRLGTAEIESALVSHPA
IAEAAVIGLPHEVKGQAIHCYCLLRQGFKPSPELEDEVKQHVAQHLGPIVRPEKVTFVDS
LPKTRSGKIMRRVLKARAQGLPEGDVSTLEE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaagccgcagctggaaggtgaggtcttcttcccctccgccgaggtggtctcg
caggcgcgcgtgccggactgggccgcgctggcgaagcgcgccgacgaggacctcgagggc
ttctgggccgcggaggccgaggagctcgagtggtaccgcaagtgggacaaggtcctcgac
gcctcggagaagccgttctaccggtggttcaagggcgcgcagaccaacatcgtccacaac
tgcctggatcgccaccagcgcacgtggcgcaagaacaagctctcgctggtgtgggtgggc
gagaagggcgaggtccgcacctactcgtacttcgcgctgaaccgcgacgtctccaagttc
gccaacgtcctgaaggccatgggcgtgaagaagggcgaccgcgtcaccatctacatgccg
cgcatccccgagatcgtgatcgccatgctggcggccgcgaagatcggcgccatccactcg
gtggtgtacggcgggttctcggtggacgcgctgcagggccgcatcgaggactcggagtcg
aaggtcgtgatcaccgccgacggcgggttcatgaacggcaagatcgtcgagctgaagaag
acggtggacgacgccgtccgccgctgcccgacggtggagacggtcatcgtggtgcagcgc
accgcgcacgaggtccgcatggaggcgggccgcgactactggtaccacgagctgatgaag
ctccccctcgccgcgggcgtctgcccgaccgaggtgatggacgccaccgacccgctctac
atcctctacacctccggcaccaccgggaagccgaaggggctcatccacgggcacggcggc
taccaggtcggcatctactccacgctcaagtacgtcttcgacatcaaggacgaggaccgc
tactggtgcgcggcggatccgggctgggtcaccggccacagctacatcgtgtacgggccg
ctgctgatgggcgcgaccacgttcatgtacgagggcgcgccgacctacccgtacccgaac
cgctggtggtcgctggtggagaagtacggcatcaccatcctctacaccgcgccgaccgcc
atccgcgggctgatgcgcttcggcgagtcgtggccgaaccgccacgacctctccaccctg
cggctgctcggctcggtgggcgagcccatcaaccccgaggcgtggaagtggtaccaccgc
gtcatcggcaagggccgttgcccggtgatggacacgtggtggcagaccgagaccggcatg
ttcatgatcacgccggtcccgacgctcccgctgaagcccggctcggcggcgaagccgttc
ttcggccagcaggtctcgatcctcgacgagaccggcaagccggtccccgacggcgaggag
ggcttcctggtcctggagcggccctggccggcgatggccatgaccgtctacaaggaccct
gaacggttcgtgaagacctactgggagaagtacccgggccgctacatggcgggcgacgcc
gccaagcgcgacgcggacggctactactgggtcatcggccgcaccgacgacgtcatcaag
gtctcgggctaccggctcggcaccgcggagatcgagagcgcgctcgtctcgcaccccgcc
atcgccgaggcggcggtgatcgggctgccgcacgaggtgaaggggcaggccatccactgc
tactgcctgctgcgccagggcttcaagcccagccccgagctggaggacgaggtgaagcag
cacgtggcgcagcacctcgggcccatcgtgcggccggagaaggtgacgttcgtggactcg
ctgcccaagacgcgctccggcaagatcatgcggcgcgtgctcaaggcgcgcgcccagggg
ctccccgagggcgacgtctccacgctcgaggagtga

DBGET integrated database retrieval system