KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3457Help
Entry
Adeh_3457         CDS       T00326                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Adeh_3457
Enzymes [BR:ade01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Adeh_3457
Exosome [BR:ade04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Adeh_3457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3976317..3977795)
Genome map
AA seq 492 aa AA seqDB search
MASYVLAIDQGTTGTTVLVLDRRLSPRARVNQEFRQIFPKPGWVEHDLEDIWGSTASTVQ
RALREAGIRGSDVAAVGITNQRETTALWERRSSRAVAHAIVWQDRRTTDACAQLRSAGHE
PLVRERTGLVLDPYFSGTKLRWLLDHTKGARQKAEAGELAFGTIDSFLVWRLTGGAAHVT
DVSNASRTLLMDLRARRWDRELLDLFGVPPNVLPEIRSSSEVYGTTRGVKVLPDGIPVAG
MAGDQQAALFGQACFRPGEAKCTYGTGAFLLQNVGPEPVMSSRGLLTTVAWTVGGETAYA
LEGSSFIAGAAVQWLRDGLGLIARAPDVEALAKQVKSTGELVFVPALAGLGAPHWRPEAR
GLIAGIDRSTTAAHLARATLEGIAFLIHDLAEAMRAEAGKPFPVFKVDGGASQNDLLMQF
QADLLEVPVERPRMIETTALGAAFLAGLAVGFWKDREEIRRAWQVGKRFEPKMKPVEREQ
HVAKWRRAVQAA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtggccagctacgtcctcgccatcgaccagggcaccaccggcaccaccgtgctggtcctc
gaccggcggctctcgccgcgcgcgcgggtcaaccaggagttccggcagatcttcccgaag
ccgggctgggtcgagcacgatctcgaggacatctggggctcgaccgcgtccacggtccag
cgcgcgctgcgcgaggcgggcatccgcggctccgacgtggcggcggtgggcatcacgaac
cagcgggagaccaccgcgctctgggagcggcgctcctcgcgcgcggtggcgcacgccatc
gtctggcaggaccgccgcaccaccgacgcgtgcgcgcagctccgctccgccgggcacgag
ccgctggtccgcgagcgcaccgggctcgtgctcgacccgtacttctccggcaccaagctg
cggtggctgctcgaccacaccaagggcgcgcggcagaaggccgaggccggcgagctggcg
ttcggcaccatcgacagcttcctggtgtggcggctcaccggcggcgcggcgcacgtcacc
gacgtctcgaacgcgagccgcacgctgctcatggacctgcgggcccggcgctgggaccgc
gagctcctggacctgttcggcgtcccgccgaacgtgctgccggagatccgatcgtcgtcg
gaggtgtacggcaccacccgcggcgtgaaggtgctgccggacggcatcccggtggcgggc
atggccggcgaccagcaggcggcgctgttcggccaggcctgcttccggccgggcgaggcg
aagtgcacctacggcaccggcgcgttcctgctgcagaacgtcgggccggagccggtgatg
tcgtcgcgcggcctgctcaccacggtcgcgtggacggtgggcggcgagacggcgtacgcg
ctggagggctcgtcgttcatcgccggcgccgcggtccagtggctccgcgacgggctgggg
ctcatcgcccgcgcgccggacgtggaggcgctcgcgaagcaggtgaagtccaccggcgag
ctggtgttcgtgccggcgctggccgggctgggcgcgccgcactggcggccggaggcgcgc
ggcctcatcgcgggcatcgaccggagcaccaccgcggcgcacctggcgcgcgccacgctc
gaggggatcgcgttcctcatccacgacctcgccgaggccatgcgcgccgaggcgggcaag
ccgttcccggtgttcaaggtggacggcggcgcgtcgcagaacgacctgctcatgcagttc
caggccgacctgctcgaggtgccggtggagcggccgcggatgatcgagaccaccgcgctc
ggcgccgcgttcctggccggcctggcggtgggcttctggaaggaccgcgaggagatccgc
cgcgcctggcaggtggggaagcgcttcgagccgaagatgaagccggtcgagcgcgagcag
cacgtcgccaagtggcggagggcggtccaggcggcgtag

DBGET integrated database retrieval system