KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3458Help
Entry
Adeh_3458         CDS       T00326                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3977799..3978671)
Genome map
AA seq 290 aa AA seqDB search
MVRTSSARGDEFDLPGGPDAVLLLHGLTGSTFEVLPVAERLHAAGMRCLAPRMAGHAGGP
EALGAVSYTEWIAQARRDLERLAGARRTFLVGCSMGALVACALAHDHPARADGLVLLAPA
LELQLQGRLGALLGRLGPLRRVVIPKAAGSDVRDPEMRAANPAFPGVPLGAVAELAKLAR
HVDAQLPGIAAPALVIAGGHDHTVTLGGARRLARRIGSGPAALRVLPESWHLVGIDVERE
RCAEAAARFLEALPVPGGRRRADRPAPARRRKAGATAPKAKGGAGRRRRR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtggtccggacctccagcgcgcgtggcgacgagttcgacctcccgggcgggcccgacgcg
gtcctgctgctgcacggcctcaccggctcgacgttcgaggtcctccccgtggcggagcgg
ctccacgccgccggcatgcgctgcctcgccccgcggatggccggccacgccggcggtccg
gaggcgctcggcgcggtctcgtacaccgagtggatcgcgcaggcccggcgcgacctggag
cggctcgccggcgcgcgccggacgttcctggtgggctgctcgatgggcgcgctcgtcgcg
tgcgcgctcgcccacgaccacccggcgcgcgcggacggcctggtgctcctcgccccggcg
ctcgagctgcagctccagggccggctgggcgcgctgctggggcgcctcggcccgctccgg
cgcgtggtgatcccgaaggcggccggctccgacgtgcgcgaccccgagatgcgcgcggcg
aacccggccttcccgggcgtgccgctcggggcggtggccgagctggcgaagctggcgcgc
cacgtggacgcgcagctgcccggcatcgccgcgccggcgctggtcatcgcgggcgggcac
gaccacaccgtcacgctcggcggcgcgcgccgcctggcgcggcgcatcggctccggcccc
gccgcgctgcgggtgctgccggagagctggcacctcgtcggcatcgacgtggagcgggag
cgctgcgccgaggcggccgcgcgcttcctggaggcgctgcccgtgccgggcggccgccgg
cgggcggaccggcccgcgccggcccggcggcggaaggcgggcgcgacggcgccgaaggcg
aagggcggcgccgggcgcaggcgcaggaggtga

DBGET integrated database retrieval system