KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3469Help
Entry
Adeh_3469         CDS       T00326                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Adeh_3469
   00052 Galactose metabolism
    Adeh_3469
   00500 Starch and sucrose metabolism
    Adeh_3469
   00520 Amino sugar and nucleotide sugar metabolism
    Adeh_3469
Enzymes [BR:ade01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Adeh_3469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3988899..3989768
Genome map
AA seq 289 aa AA seqDB search
MAPKKIRKAVIPAAGLGTRFLPATKAVPKELLPIVDTPTIQYIVAEAVAAGVRDIILICA
RGKDSIVDHFDIAGELEDRLEKAGKHELRKQMREIAHMANVLTIRQQEPLGLGHAVLCAR
DAIGDEPFVVMLGDDIIDAPVPGAKQLADCWERHGLGTVALMEVPREDTPMYGIAAGQAM
DSRTVRIERLVEKPKADPPSNLAVIGRYVLPPRIFEILERVKPGVGGEIQLTDALAVLAR
EEGLLGYRFEGERYDAGDRFGYLKANILYAMKRPELAGPLRALMKELVK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaagaagatccgcaaggccgtgatccccgccgcgggcctcggcacccggttc
cttcccgccaccaaggcggtcccgaaggagctgctcccgatcgtagacacgcccaccatc
cagtacatcgtggccgaggcggtcgcggccggcgtccgggacatcatcctcatctgcgcg
cgcggcaaggactcgatcgtcgatcacttcgacatcgccggcgagctggaggaccgcctg
gagaaggcgggcaagcacgagctgcgcaagcagatgcgcgagatcgcccacatggcgaac
gtgctcaccatccgccagcaggagccgctcgggctcgggcacgcggtgctgtgcgcgcgc
gacgccatcggcgacgagcccttcgtggtgatgctcggcgacgacatcatcgacgcgccg
gtgcccggcgcgaagcagctcgccgactgctgggagcggcacgggctcggcacggtggcg
ctcatggaggtgccgcgcgaggacacgccgatgtacggcatcgccgcgggccaggcgatg
gactcgcgcaccgtgcgcatcgagcgcctggtggagaagccgaaggcggatccgccctcc
aacctggccgtgatcggccgctacgtcctgcccccgcgcatcttcgagatcctggagcgc
gtgaagccgggcgtgggcggcgagatccagctcaccgacgcgctggcggtgctggcgcgc
gaggaggggctgctcgggtatcggttcgagggcgagcgctacgacgcgggcgaccgcttc
ggctacctgaaggccaacatcctgtacgcgatgaagcgccccgagctggcggggccgctc
cgcgcgctcatgaaggagctcgtcaagtga

DBGET integrated database retrieval system