KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3469Help
Entry
Adeh_3469         CDS       T00326                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00040  Pentose and glucuronate interconversions
ade00052  Galactose metabolism
ade00500  Starch and sucrose metabolism
ade00520  Amino sugar and nucleotide sugar metabolism
ade01100  Metabolic pathways
ade01130  Biosynthesis of antibiotics
Module
ade_M00362  Nucleotide sugar biosynthesis, prokaryotes
ade_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Adeh_3469
   00052 Galactose metabolism
    Adeh_3469
   00500 Starch and sucrose metabolism
    Adeh_3469
   00520 Amino sugar and nucleotide sugar metabolism
    Adeh_3469
Enzymes [BR:ade01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Adeh_3469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABC83235
UniProt: Q2IF76
Position
3988899..3989768
Genome map
AA seq 289 aa AA seqDB search
MAPKKIRKAVIPAAGLGTRFLPATKAVPKELLPIVDTPTIQYIVAEAVAAGVRDIILICA
RGKDSIVDHFDIAGELEDRLEKAGKHELRKQMREIAHMANVLTIRQQEPLGLGHAVLCAR
DAIGDEPFVVMLGDDIIDAPVPGAKQLADCWERHGLGTVALMEVPREDTPMYGIAAGQAM
DSRTVRIERLVEKPKADPPSNLAVIGRYVLPPRIFEILERVKPGVGGEIQLTDALAVLAR
EEGLLGYRFEGERYDAGDRFGYLKANILYAMKRPELAGPLRALMKELVK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaagaagatccgcaaggccgtgatccccgccgcgggcctcggcacccggttc
cttcccgccaccaaggcggtcccgaaggagctgctcccgatcgtagacacgcccaccatc
cagtacatcgtggccgaggcggtcgcggccggcgtccgggacatcatcctcatctgcgcg
cgcggcaaggactcgatcgtcgatcacttcgacatcgccggcgagctggaggaccgcctg
gagaaggcgggcaagcacgagctgcgcaagcagatgcgcgagatcgcccacatggcgaac
gtgctcaccatccgccagcaggagccgctcgggctcgggcacgcggtgctgtgcgcgcgc
gacgccatcggcgacgagcccttcgtggtgatgctcggcgacgacatcatcgacgcgccg
gtgcccggcgcgaagcagctcgccgactgctgggagcggcacgggctcggcacggtggcg
ctcatggaggtgccgcgcgaggacacgccgatgtacggcatcgccgcgggccaggcgatg
gactcgcgcaccgtgcgcatcgagcgcctggtggagaagccgaaggcggatccgccctcc
aacctggccgtgatcggccgctacgtcctgcccccgcgcatcttcgagatcctggagcgc
gtgaagccgggcgtgggcggcgagatccagctcaccgacgcgctggcggtgctggcgcgc
gaggaggggctgctcgggtatcggttcgagggcgagcgctacgacgcgggcgaccgcttc
ggctacctgaaggccaacatcctgtacgcgatgaagcgccccgagctggcggggccgctc
cgcgcgctcatgaaggagctcgtcaagtga

DBGET integrated database retrieval system