KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3583Help
Entry
Adeh_3583         CDS       T00326                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00900  Terpenoid backbone biosynthesis
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Adeh_3583
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Adeh_3583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ABC83349
UniProt: Q2IFJ3
Position
complement(4109154..4110377)
Genome map
AA seq 407 aa AA seqDB search
MPGARRRDAGRRGREEPVKRVAILGSTGSIGVQALDVVGRFPDRFEVVGLAAGRNAPRLL
EQIRRFRPRVVSVCDEAAARAVRAEAPPGTEVLSGDAGAVAVASHPDAAFVLAAISGGAG
LRSTAAAIEAGKPVGLANKESMVLAGELLMARAAAKGVAILPVDSEHSAIHQSLVGHNRG
EVRRLILTASGGPLRCTPAAELAAVTPERALKHPNWSMGDKITIDSATLMNKGLEVIEAR
WLFGVEQQRIDIVVHPESVVHSMVEYVDGSIVAQLGISDMRGPISYAMGHPERMPLDLPP
LDLGRLGKLTFEPPDPARFPAYTLAYRALELGGTAPAVLSGADEAAVAAFLARRCSFTQI
ADVCADVLEAHVAEPVRSVEQALAASEHGRREAEKRVGALARAPAGR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggggcgcggcggcgcgacgccggccggcgtggtagagaggagcccgtgaagcgc
gtcgccatcctcgggtccaccggctccatcggcgtccaggcgctcgacgtggtggggcgc
ttccccgaccgcttcgaggtggtgggcctcgccgccgggcgcaacgcgccgaggctgctc
gaacagatccggcgcttccgcccgcgggtggtctccgtctgcgacgaggccgccgcccgc
gccgtgcgggccgaggcgccccccggcaccgaggtgctctccggcgacgcgggcgcggtg
gcggtcgcgagccaccccgacgcggcgttcgtgctcgcggccatctccggcggcgccggg
ctccgctccaccgcggcggccatcgaggcgggcaagccggtggggctcgcgaacaaggag
tcgatggtcctcgcgggcgagctgctcatggcccgcgccgccgcgaagggcgtcgccatc
ctgccggtggactcggagcacagcgccatccatcagtcgctcgtcggccacaaccgcggc
gaggtgcggcgcctcatcctcaccgcgtccggcgggccgctgcgctgcacgcccgcggcg
gagctggccgcggtcacgcccgagcgcgccctcaagcacccgaactggtcgatgggcgac
aagatcaccatcgactccgccaccctgatgaacaaggggctggaggtcatcgaggcccgg
tggctgttcggggtggagcagcagcgcatcgacatcgtggtgcacccggagtcggtggtg
cactcgatggtcgagtacgtggacggctccatcgtggcgcagctcgggatctccgacatg
cgcgggccgatcagctacgcgatgggccacccggagcgcatgccgctcgacctcccgccg
ctcgatctcgggcggctcggcaagctcaccttcgagccgccggatccggcgcgcttcccc
gcctacacgctggcgtaccgcgcgctcgagctcggcggcaccgcgcccgcggtgctctcc
ggcgccgacgaggcggccgtggccgcgttcctggcgcgccgctgcagcttcacgcagatc
gccgacgtctgcgccgacgtgctcgaggcgcacgtggcggagccggtgcgctcggtggag
caggcgctcgccgcgagcgagcacggccggcgcgaggccgagaagcgcgtcggcgcgctg
gcgcgcgctccggcggggcgatag

DBGET integrated database retrieval system