KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3766Help
Entry
Adeh_3766         CDS       T00326                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Adeh_3766
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Adeh_3766
Enzymes [BR:ade01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Adeh_3766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4313737..4315251
Genome map
AA seq 504 aa AA seqDB search
MVSPAVSDMRLSTVIAGSGARGDLAGDPEITRVTGDSREVIPGAVFFALPGVQHDGHAFA
AEAARRGAVAVVAERPVECAPARLLLAPSARRAMALAAASFCGRPAERLRMAAVTGTNGK
TTVTYLVEACARAAAVPVGVLGTISFRFPGAERPASHTTPESTAIQAVLAEMVEAGARDA
VMEVSSHALAQERVAGIRFQAAGFTNLTRDHLDYHRDMEAYFAAKRRLFTEHLAPGGTAV
INARDPWGARLADQLGPGPRVWRYGGRAGDALRALEVRTGLAGTSATFETPAGAIAIRSP
LVGQHNLENLLCAAGLALGLGLPPEAVARGLAASHGAPGRLERIDGRGLSVFVDYAHTDD
ALARMIAALRGLSPRRLVCVFGCGGDRDRGKRPLMGAAAAAADLAIVTSDNPRTEDPLAI
IADVLPGLDRAGKPAIGAARARAGEDGYVVEPDRRAAIALAVECAREGDAVLVAGKGHED
YQQVGAERRPFSDRDEARKALGIA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtatctcccgcggtaagcgacatgaggctctccaccgtcatcgccggcagcggcgcc
cgcggcgatctcgccggcgatccggagatcacgcgcgtcaccggcgactcgcgcgaggtc
atccccggcgcggtgttcttcgcgctgcccggcgtccagcacgacggccacgcgttcgcg
gccgaggcggcgcggcggggcgccgtcgcggtggtcgccgagcggccggtcgagtgcgcc
cccgcccggctgctgctcgcgccgtccgcccgccgcgccatggccctcgccgccgccagc
ttctgcggccggcccgccgagcgcctgcgcatggccgcggtcaccggcacgaacggcaag
accaccgtcacctacctggtggaggcgtgcgcgcgcgccgccgcggtgccggtgggcgtc
ctcggcaccatctccttccgcttccccggcgccgagcggccggccagccacaccaccccg
gagtccaccgccatccaggcggtgctggcggagatggtcgaggccggcgcgcgggacgcg
gtgatggaggtgtcgtcgcacgcgctcgcgcaggagcgggtggccgggatccgcttccag
gctgccggcttcaccaacctcacgcgcgaccacctcgactaccaccgcgacatggaggcg
tacttcgccgcgaagcgccggctcttcaccgagcacctcgcgccgggcggcaccgcggtg
atcaacgcgcgcgatccctggggcgcgcgcctcgccgaccagctcgggccggggccgcgc
gtctggcgctacggcggccgggccggcgacgcgctgcgcgcgctcgaggtccggaccggc
ctcgccggcaccagcgcgaccttcgagaccccggccggcgccatcgccatccgctccccg
ctcgtcggccagcacaacctcgagaacctgctctgcgccgccggcctcgcgctcggcctg
ggactgccgcccgaggcggtcgcccgcggcctggccgcctcgcacggcgcgcccggccgg
ctggagcggatcgacggccgcggcctctcggtgttcgtggactacgcgcacaccgacgac
gcgctggcgcgcatgatcgcggcgctgcgcgggctctccccgcggcgcctggtgtgcgtg
ttcggctgcggcggcgaccgggaccggggcaagcgcccgctcatgggcgcggcggccgcg
gccgcggacctcgccatcgtgacgagcgacaacccccgcaccgaggatccgctcgcgatc
atcgccgacgtgctgcccggcctggaccgcgccggcaagcccgccatcggcgccgcccgg
gcgcgcgccggcgaggatggctacgtggtggagccggaccggcgcgcggccatcgcgctc
gcggtcgagtgcgcgcgcgagggcgacgcggtgctcgtcgccggcaaggggcacgaggac
taccagcaggtgggcgccgagaggcgccccttctccgaccgcgacgaggcgcgcaaggcg
ctcgggatcgcatga

DBGET integrated database retrieval system