KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3905Help
Entry
Adeh_3905         CDS       T00326                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ade01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ade00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ade00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4505062..4507365
Genome map
AA seq 767 aa AA seqDB search
MIRADILEQFPELFGRKRVNGRELDVDATIETLTRELEPEIEAALTARGALLRSPEPVAT
KYAWPHWNEAFEDPVGGSAWTFRQIVQGMIDNFLGKESPLRWRLNDEVAIPEHVHPSRNP
GLELTGPWHPLDMAFNALNSPAPMNMPDFEDASPPHFRPDGAPAREPVGVFAALKNAKEI
FEGRWSDRAYEVEKKGKKRSYRITTPQAKWPTRLARPPSLHIRYDHVTVDGRPAPGLVVV
ATLWALNGYDALTRAGSGAYFYIPKLQTPREALIVERLLSRLEGMMGVPAGTLKAKMLYE
EGNAGRQLPAIVWTLRRRLLGTNVGRWDYLGSLIEMWKDDPQGVFPDPQTIGMATPGMLA
YQRYNALLMLMAGMKDGELTHAAPIGGMAAVMIYQAGDPYGRARYNPLALRAMVIDKLRE
RLLGLFFVPDAPLRPGEQPTLDAVLGGKVRGALHDAYRQSWVASPEPEYVGAGNGPLRAR
VGALQELLDAPVETVDAGGKQVPTVASGLSDDERALFRSRGLVDANGRITPFVLAREQVD
APEKLLDLARWEAIYRVPEGDVTIEHVQHAFYMAANYGFQILNGNFAAAIDDYELKLRFM
NDLATYRINVSWLWALLRHQAPVTKDGHLLRATLTGDGVVLGKPAEPVKAGTRLDRALFE
KVYTFHGEWTDAFFAEQDRRGEPARFDRSKAPVIMELLHRQLLSKRYIQHSARALFVIGA
ARPEDRAGLLDAMFDLERAEVAARVEKGALPNGALEAHDYVNDVFGG
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgcggacatcctcgagcagttccccgagctgttcggccgcaagcgcgtcaac
ggccgcgagctcgacgtggacgcgaccatcgagacgctcacccgcgagctcgagccggag
atcgaggcggcgctgaccgcgcgcggcgcgctgctccgctcgcccgagccggtggccacg
aagtacgcgtggccgcactggaacgaggcgttcgaggacccggtcggagggagcgcctgg
acgttccggcagatcgtccaggggatgatcgacaacttcctcggcaaggagagcccgctg
cgctggcggctcaacgacgaggtggcgatccccgagcacgtgcacccgtcgcgcaacccg
ggcctggagctgaccgggccctggcacccgctcgacatggcgttcaacgcgctcaacagt
cccgcgccgatgaacatgccggacttcgaggacgcctcgccgccgcacttccgccccgac
ggcgcgccggcgcgcgagccggtgggcgtgttcgcggcgctcaagaacgcgaaggagatc
ttcgaggggcgctggtcggaccgcgcctacgaggtcgagaagaaggggaagaagcgcagc
taccggatcacgacgccgcaggcgaagtggcccacgcgcctcgcccgcccgcccagcctg
cacatccgctacgaccacgtcacggtggacggccggcccgcgccgggcctggtggtggtc
gcgacgctctgggcgctgaacggctacgacgcgctcacccgcgccgggagcggcgcgtac
ttctacatccccaagctgcagacgccgcgcgaggcgctcatcgtggagcggctgctctcg
cggctcgaggggatgatgggcgtgcccgccggcacgctcaaggcgaagatgctctacgag
gaggggaacgccggccgccagctccccgccatcgtctggacgctgcggcgccggctgctc
ggcacgaacgtcggccgctgggactacctcggcagcctcatcgagatgtggaaggacgat
ccgcagggcgtgttccccgacccgcagacgatcggcatggcgacgcccggcatgctcgcg
taccagcgctacaacgcgctgctcatgctgatggcgggcatgaaggacggcgagctgacc
cacgccgcgcccatcggcggcatggcggcggtgatgatctaccaggccggcgatccctac
ggccgcgcccgctacaacccgctcgcgctccgcgccatggtgatcgacaagctgcgcgag
cggctgctgggcctgttcttcgtgcccgacgcgccgctgcggcccggcgagcagcccacc
ctcgacgccgtcctcggcggcaaggtccgcggcgcgctccacgacgcgtaccgccagagc
tgggtggcgagcccggagccggagtacgtcggcgccggcaacggcccgctccgcgcgcgc
gtcggcgcgctccaggagctgctcgacgcgccggtggagaccgtggacgcgggcgggaag
caggtgcccacggtggcgagcgggctctccgacgacgagcgggcgctgttccgctcgcgc
gggctcgtggacgcgaacgggcgcatcacgccgttcgtgctggcgcgcgagcaggtggac
gcgccggagaagctgctcgacctggcgcgctgggaggcgatctaccgggtgccggaaggc
gacgtcaccatcgagcacgtgcagcacgcgttctacatggcggcgaactacggcttccag
atcctgaacggcaacttcgccgccgccatcgacgactacgagctgaagctccgcttcatg
aacgacctcgccacctaccgcatcaacgtgtcgtggctgtgggcgctcctgcgccaccag
gcgcccgtcacgaaggacggccacctgctccgcgccacgctcaccggcgacggcgtggtg
ctcggcaagcccgccgagccggtgaaggccgggacgcgcctcgaccgcgcgctgttcgag
aaggtgtacacgttccacggtgagtggacggacgcgttcttcgccgagcaggaccgccgc
ggcgagcccgcgcgcttcgaccgctccaaggcgcccgtcatcatggagctgctgcaccgc
cagctcctctccaagcgctacatccagcacagcgcccgcgcgctgttcgtgatcggcgcc
gcccgccccgaggaccgcgccggcctgctcgacgccatgttcgacctcgagcgcgccgag
gtggccgcgcgggtggagaagggcgcgctcccgaacggcgcgctggaggcgcacgactac
gtgaacgacgtgttcggggggtag

DBGET integrated database retrieval system