KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_4057Help
Entry
Adeh_4057         CDS       T00326                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00260  Glycine, serine and threonine metabolism
ade00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01130  Biosynthesis of antibiotics
ade01230  Biosynthesis of amino acids
Module
ade_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeh_4057
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Adeh_4057
Enzymes [BR:ade01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Adeh_4057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABC83821
UniProt: Q2IGW3
Position
4666890..4668185
Genome map
AA seq 431 aa AA seqDB search
MKTAALPDERGRFGAFGGRFVPETLVPALDELEQAWREARADPAFQAELDELLRRYAGRE
TPVSEAPRMSADVGGCRVLLKREDLCHTGSHKLNNTLGQILLARRMGKKRIIAETGAGQH
GVATATAAALFGLPCEVYQGAVDVERQALNVFRMQLLSARVIPVTSGSATLKDAMNEALR
DWVTNVRDTHYIIGSVAGPHPYPAMVRTFQSVIGREARRQVLELAGRLPDAVVACVGGGS
NAMGIFSAFVDDAHVDLVAAEAAGLGLSTAKHGASLAKGTPGVLHGSRSYVLQDGHGQIQ
EAHSISAGLDYPGVGPELSYLKDQGRLTLLPQTDAEALDAFQYLARMEGIIPALESAHAV
SAARKVARDAGPGGLVLVNVSGRGDKDVEQVRKMLEAAPPPRRTRARPARPAKKAKANAR
PRAAARKGGRR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccgcagccctccccgacgagcgggggcgcttcggcgccttcggcgggcgcttc
gtgcccgagaccctggtgccggcgctggacgagctcgagcaagcctggcgcgaggcgcgg
gccgacccggcgttccaggcggagctggacgagctgctccggcgctacgccgggcgcgag
accccggtgtccgaggcgccgcgcatgagcgccgacgtgggcggctgccgcgtgctgctg
aagcgcgaggacctgtgccacaccggctcgcacaagctcaacaacacgctcggccagatc
ctgctcgcccgccgcatgggcaagaagcggatcatcgccgagaccggcgccggccagcac
ggcgtcgccaccgccaccgccgcggcgctgttcggcctgccctgcgaggtctaccagggc
gcggtggacgtggagcggcaggcgctcaacgtcttcaggatgcagctgctcagcgcgcgc
gtcatcccggtgacgtccggctcggcgacgctcaaggacgcgatgaacgaggcgctgcgc
gactgggtcaccaacgtccgcgacacgcactacatcatcggctcggtggccggcccgcac
ccctacccggccatggtccgcacgttccagtcggtgatcgggcgcgaggcgcgccggcag
gtgctggagctggccggccggctgcccgacgcggtggtcgcctgcgtgggcggcggctcc
aacgccatgggcatcttctcggcgttcgtggacgacgcgcacgtggacctggtcgccgcg
gaggccgccggcctcgggctctcgaccgcgaagcacggcgcgtcgctcgcgaaggggacc
ccgggcgtgctgcacggctcgcggagctacgtgctccaggacgggcacgggcagatccag
gaggcgcactcgatcagcgccggcctcgactacccgggcgtcgggccggagctctcctac
ctgaaggaccagggccggctcacgctgctgccgcagaccgacgccgaggcgctggacgcg
ttccagtacctcgcgcgcatggaggggatcatccccgcgctggagagcgcgcacgcggtc
tcggccgcgcgcaaggtggcccgcgacgccgggccgggagggctggtgctcgtgaacgtc
tccgggcgcggcgacaaggacgtggagcaggtgcggaagatgctcgaggcggcgccgccg
ccgcggcgcacccgggcccgcccggcccggcctgcgaagaaggcgaaggcgaacgcgcgc
ccgcgcgccgccgcccggaagggaggccgccggtga

DBGET integrated database retrieval system