KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_4058Help
Entry
Adeh_4058         CDS       T00326                                 

Definition
tryptophan synthase, alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Adeh_4058
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeh_4058
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Adeh_4058
Enzymes [BR:ade01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Adeh_4058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4668182..4669039
Genome map
AA seq 285 aa AA seqDB search
MSPRTARKPRAAAAPAAAERPDRITAAFERCRAERRAALVTYVMGGDPDLATARDMALAC
VEGGADLVELGVPFSDPIADGPTIQAAAQRALGAGTTLEDVLGIAAAVRARSQVPIALMG
YLNPMLAGGVERLVRGCADAGVDALIIPDLLPEEAEVLAPAAAEAGVKLVYLLAPTSNPA
RVEAAVRAATGFLYFVSVTGVTGARHAVADEIAPLVSAVRSRTELPVVIGFGVATPEQAR
ALGPLADGVVVGSAIVKRIAEGGSRRARAERVKRFVRSLGRALGR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcgcaccgcccgcaagccccgcgccgccgccgcgcccgccgcggccgagcgc
cccgaccgcatcacggccgcgttcgagcgctgccgcgccgagcgccgggccgcgctcgtc
acctacgtgatggggggcgaccccgacctcgccaccgcgcgggacatggcgctcgcctgc
gtggagggcggcgccgacctcgtcgagctgggcgtcccgttctccgaccccatcgccgac
ggccccaccatccaggccgccgcccagcgcgcgctcggcgccggcaccacgctcgaggac
gtgctcgggatcgccgccgcggtccgcgcgcgctcgcaggtccccatcgcgctcatgggc
tacttgaaccccatgctggcgggcggggtcgagcggctcgtgcgcggctgcgccgacgcc
ggcgtggacgcgctcatcatcccggacctgctgcccgaggaggcggaggtgctcgccccg
gcggcggcggaggccggcgtgaagctcgtctacctgctcgcgcccacctccaacccggcg
cgggtcgaggccgccgtccgcgccgccaccggcttcctctacttcgtgtcggtgaccggc
gtgaccggggcgcgccacgccgtggccgacgagatcgcgccgctcgtgtcggcggtgcgg
tcccggaccgagctgccggtcgtgatcggcttcggcgtggcgacgcccgagcaggcccgt
gcgctgggcccgctcgcggacggcgtggtggtcgggagcgcgatcgtgaagcgcatcgcc
gagggcggctcgcggcgcgcccgcgccgagcgggtgaagcgcttcgtgcgatcgctcgga
cgcgcgctggggcgctag

DBGET integrated database retrieval system