KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_4065Help
Entry
Adeh_4065         CDS       T00326                                 

Definition
class II aldolase/adducin-like
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Adeh_4065
Enzymes [BR:ade01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Adeh_4065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4675272..4675979
Genome map
AA seq 235 aa AA seqDB search
MARAPRPRAVLPRAAPRARTAPRERALADAVVETCHRLAALDLIGAGEGNVSVRLGPDAF
LVTASGVNKGLLRPGHVLRIDGAGAVTRGAGRPSTELRMHLAAYAARPDVEAIVHAHPIT
AVALTVAGVPPPNDLVPEAAVTLGEIALAPFATPGTGEVPASLAPYLARHDVLLLERHGA
LALGRTLSEALDRMETLERVARIALAARLAGRCTPLPADAVDRVLLAAGKPARKR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcgctccccgcccgcgcgccgtcctcccccgcgccgcgccccgcgcgcggacc
gccccgcgggagcgcgcgctcgccgacgcggtggtggagacctgccaccggctggccgcg
ctcgacctcatcggcgccggcgaggggaacgtctcggtgcggctcgggccggacgcgttc
ctggtcaccgcctcgggcgtgaacaagggcctgctccggcccgggcacgtgctgcgcatc
gacggcgccggcgcggtgacccgcggcgcgggccgcccctcgaccgagctgcgcatgcac
ctcgccgcctacgcggcgcggccggacgtggaggccatcgtccacgcccaccccatcacc
gcggtggcgctcaccgtcgcgggcgtgccgccgccgaacgacctcgtgccggaggccgcg
gtgacgctgggcgagatcgcgctcgcgccgttcgcgacgcccggcaccggcgaggtgccc
gcctcgctcgcgccgtacctggcgcggcacgacgtgctgctgctcgagcgccacggcgcg
ctcgcgctggggcgcacgctctccgaggcgctcgaccggatggagaccctggagcgggtg
gcgcggatcgcgctcgccgcgcggctcgcggggcgctgcacgccgctgccggcggacgcg
gtggaccgggtgctcctcgccgcgggcaagccggcgcggaagcgctag

DBGET integrated database retrieval system