KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_4066Help
Entry
Adeh_4066         CDS       T00326                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ade00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4676072..4676560)
Genome map
AA seq 162 aa AA seqDB search
MRAYVGVGSNLGDRWANLALAARVLRASPRLAVLRASHVFDTPPMGPPQPRYLNAVLELE
AGLTPEALHAVLASAERAAGRRRGLRWGPRTLDLDLLVHADRVVRTPALTVPHPGIAARR
FVLEPLAELAPDLVVPGLGRTVAELLARAPGAPLVVAGLYPL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcgtacgtgggcgtgggcagcaacctcggcgatcgctgggccaacctggcgctc
gcggcccgcgtcctgcgcgcctcgccccgcctcgcggtgctgcgggcctcgcacgtgttc
gacacgccgcccatgggcccgccgcagccccgctacctgaacgccgtgctggagctggag
gccgggctcacgccggaggcgctgcacgcggtgctcgcctcggccgagcgcgccgccggc
cgccgccgcggcctgcgctggggcccgcgcacgctcgacctcgacctgctcgtccacgcg
gatcgcgtggtgcggacccccgcgctcaccgtcccgcaccccggcatcgcggcgcgccgc
ttcgtgctcgagccgctcgccgagctggcgccggacctggtggtgccggggctgggccgc
acggtggccgagctgctggcgcgcgcgccgggcgcgccgctggtggtggccggcctgtac
ccgctctga

DBGET integrated database retrieval system