KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_4101Help
Entry
Adeh_4101         CDS       T00326                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Adeh_4101
Enzymes [BR:ade01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Adeh_4101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4712565..4713677
Genome map
AA seq 370 aa AA seqDB search
MNLTDTLALLLRPAGGGIHLVSSGKAEQLALQRRLYGADDEAEIRARWREDLERAATARA
VVLGIPSDVGAGFRRGANLGPAAIRERLLADDPSRSARDRADGVVDLGDVFVVPQLLHDD
MLSEAQLAASRRALYPGVPADEAARLPVSPLSIAERALELVLEANPRARVFAVGGDHSTA
WPVVKALAPRWPGMGIVQIDAHTDLLEDRLGVRYCFGTWSYHANELVGRGGRLVQVGTRA
SGRDRAHWESTLGVRQFWAADVLADPRAALDRILEHVKATGVSSVYFSNDIDGTDQQWAD
ATGTPEPGGLTPAFVSSLVRRLGSEVGLAGGDVMEVAPGIAGGEGAGPRTVGLAAGYLAE
TIDAALGRTR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctcaccgacacgctcgcgctcctgctccgcccggccggcggcggcatccacctc
gtctcaagcggcaaggccgagcagctcgcgctgcagcgccgcctctacggcgccgacgac
gaggccgagatccgcgcccgctggcgcgaggacctggagcgcgccgccaccgcccgcgcg
gtggtgctgggcatcccctccgacgtgggcgcgggcttccgccgcggcgcgaacctgggg
ccggccgccatccgcgagcggctgctcgcggacgacccgtcgcggagcgcgcgcgaccgc
gccgacggggtggtggacctcggcgacgtgttcgtggtcccgcagctgctccacgacgac
atgctgagcgaggcgcagctcgccgccagccggcgcgcgctctacccgggcgtgccggcg
gacgaggcggcgcgcctgccggtgtcgccgctctccatcgcggagcgggcgctcgagctg
gtgctcgaggcgaacccgcgcgcccgcgtgttcgcggtgggcggcgatcactccaccgcg
tggccggtggtgaaggcgctcgcgccgcgctggcccggcatgggcatcgtgcagatcgac
gcgcacaccgacctgctcgaggaccggctcggggtccgctactgcttcggcacctggtcg
taccacgcgaacgagctggtgggccgcggcgggcggctggtgcaggtgggcacgcgcgcg
tccgggcgcgaccgcgcgcactgggagtccacgctcggcgtgcggcagttctgggccgcc
gacgtgctcgccgacccgcgcgccgcgctggaccggatcctcgagcacgtgaaggcgacc
ggcgtctcctcggtctacttctcgaacgacatcgacgggaccgaccagcagtgggccgac
gccaccggcacgccggagccgggcggcctcacgccggcgttcgtctcgtcgctcgtccgc
cgcctggggagcgaggtggggctcgcgggcggcgacgtgatggaggtcgcgccggggatc
gccggcggcgagggcgcggggccgcgcacggtcgggctcgccgcgggctacctcgccgag
accatcgacgcggcgctcggccggacccgctga

DBGET integrated database retrieval system