KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_4264Help
Entry
Adeh_4264         CDS       T00326                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ade00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Adeh_4264
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Adeh_4264
Enzymes [BR:ade01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Adeh_4264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4898758..4899855)
Genome map
AA seq 365 aa AA seqDB search
MPNPTSLDAQVAGLLCVGFDGKTASPEVLELIRRGVHGVVLFARNVESAEQVAALTAELK
RAAGRPLLVAVDQEGGRVARLRARHGFTELPPMRAVGEVGDAGLAREVGALLGRELRAVG
IDQDYAPVVDVDTNPANPVIGDRSLSRDPETVGRLGAAIALGLQSAGVAACAKHFPGHGD
TSQDSHTDLPRLPHALERLRAVELAPFRALARAGVASVMTAHVVFEALDRDRPATLSPRV
MRLLREEVGFDGCAISDDLEMEAVAGHFPLEESAPGAVAAGVDALLVCHSPAVQHRAIDL
VRAAVEAGRIPAERVAEARGRVGRLLAYAGPPPDPARVRERLRTPEHLALVQNVPALEIG
RDPTA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaacccgacctccctcgacgcccaggtcgccggcctcctctgcgtcggcttcgac
ggcaagaccgcctcgcccgaggtgctcgagctcatccgccgcggcgtccacggcgtggtg
ctgttcgcgcgcaacgtggagagcgccgagcaggtggcggcgctcaccgccgagctgaag
cgcgcggcggggcggccgctcctcgtcgcggtggaccaggagggcgggcgggtggcgcgg
ctgcgggcgcgccacggcttcaccgagctgccgcccatgcgcgcggtgggcgaggtcggc
gacgccgggctcgcccgcgaggtgggcgcgctgctcggccgcgagctgcgggcggtcggg
atcgaccaggactacgcgccggtggtggacgtggacacgaaccccgccaacccggtcatc
ggcgaccggagcctctcccgcgatccggagacggtcggccgcctcggcgccgcgatcgcg
ctcgggctccagtcggccggggtggccgcctgcgcgaagcacttccccggccacggcgac
acgagccaggactcgcacaccgacctgccccgcctcccgcacgcgctcgagcggctccgg
gcggtggagctggcgccgttccgcgcgctggcgcgcgccggggtggcctcggtgatgacc
gcgcacgtggtgttcgaggcgctcgaccgcgaccgcccggccacgctctcacccagggtg
atgcggctcctgcgcgaggaggtcgggttcgacggctgcgccatctccgacgacctggag
atggaggcggtggccgggcacttcccgctggaggagtcggcgccgggggcggtggcggcc
ggggtggacgcgctgctcgtgtgccactcgcccgcggtacagcaccgggccatcgacctg
gtgcgggccgcggtggaggcgggtcgcatcccggcggagcgggtcgccgaggcccggggc
cgggtgggtcggctgctcgcgtacgcgggtccgccgccggacccggcccgggtgcgggag
cgcctgcgcacgccggagcacctggcgctggtccagaacgtccccgcgctcgagatcggc
cgcgacccgaccgcctga

DBGET integrated database retrieval system