KEGG   Acropora digitifera (stony coral): 107354360Help
Entry
107354360         CDS       T04352                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
adf  Acropora digitifera (stony coral)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:adf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    107354360
Enzymes [BR:adf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107354360
Peptidases [BR:adf01002]
 Serine Peptidases
  Family S33
   107354360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 244 aa AA seqDB search
MEVEVISEEGYVHSSKGLKLFSKCWKLKEGTPRALIFVSHGVGEHCSKYEEFAHVLAKQG
LLVISHDHVGHGRSEGEPVQISSFSIYVADVLKHIDELSESNAGLPVFLLGHSMGGTISI
LCAMERPQFFAGLVLCAPAILANPKTATRFMIFLGRVVSYVAPSFQVVRSEDYSALTRDP
EQVMPITLNNPLNLRVKFSFNRFRNFEDAMVNLVSRSWKIFEMIIAMFCKWVYIYRLTHS
ASEL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcgaggtcatatccgaggaaggttatgtacatagttcaaagggtttgaagttg
ttctccaagtgttggaaattaaaagagggaactcctcgtgctctgatatttgtgagtcac
ggcgttggagaacactgttctaagtatgaagaatttgcacacgtactagccaagcaaggc
ctccttgtcatctcccatgatcatgttgggcatggtagaagtgaaggagaaccggtgcaa
atatcatcatttagcatttatgttgctgatgttcttaagcatattgatgagttgtctgaa
agtaatgcaggattgcctgtctttctgcttggtcattcaatgggaggtaccatttccata
ctttgtgccatggaaaggcctcagttctttgctggacttgtgctctgtgccccagcaata
ttggcaaacccaaagactgcaactcgcttcatgatatttttgggaagagtagtttcatat
gttgcaccatcatttcaagttgttagatctgaagattattctgcacttactagagaccct
gaacaggtaatgccaattaccctcaataatcctttaaacttgagggtaaaatttagtttt
aacagatttaggaactttgaagatgctatggtaaatttagtgtcaagatcctggaaaatc
tttgagatgataatagcgatgttttgtaaatgggtttatatttacaggttaacacactcg
gcgagtgaattatag

DBGET integrated database retrieval system